Pricing
TAGS

Tagged Content

Tagged: customer-experience

Everything on the platform tagged with customer-experience.

Browse all tags
biotechnology12biotech11saas11ai8defense7supply chain6b2b6robotics6machine learning6computer vision6drug discovery6oncology6clinical-stage5enterprise software5digital health5clean energy5san francisco5fintech5proptech4energy4medical devices4fleet management4new york startup4biologics4telehealth4precision medicine4ai agents4series a4climate tech4drug-discovery3cambridge-biotech3marketplace3inventory management3blockchain3critical infrastructure3drug-development3financial services3natural language processing3healthtech3hipaa compliant3energy storage3edtech3b2b saas3car-t3los angeles3cambridge3renewable energy3agentic ai3immunotherapy3deep tech3immuno-oncology3warehouse automation3precision-medicine2real estate technology2y combinator2web32cybersecurity2medtech2clinical stage2edge computing2industrial automation2developer tools2adtech2antibody discovery2neuroscience2neurology2metabolic-health2glp-12obesity2business intelligence2ehr integration2patient engagement2care coordination2multimodal ai2advisory2drones2aerospace2professional development2human performance2d2c2home appliances2gig economy2user-generated content2general catalyst2cell therapy2automation23pl2digital assets2multi-omics2san-diego-biotech2series-a2unicorn2healthcare2microbiome2last mile delivery2cell-therapy2solid-tumors2ai drug discovery2hardware2darpa2counter-uas2autonomous drones2additive-manufacturing2education technology2generative ai2buy now pay later2wellness2circular economy2startup2dark web monitoring2public benefit corporation2ai inference2ai for science2ai-in-biotech1machine-learning1disease-redefinition1genomics1human-genetics1ipsc-models1common-diseases1parkinsons1neurodegeneration1flagship-pioneering1target-discovery1patient-derived-models1attainable housing1prefab construction1modular housing1missing middle1panelized construction1multifamily1solar powered homes1sustainable building1housing affordability1universal design1franchising1carbon neutral buildings1off-site manufacturing1construction technology1veterinary1animal health1procurement1ecommerce1purchasing platform1veterinary software1pricing transparency1distribution1vendor integration1vet tech1data privacy1zero-knowledge proofs1quantum-resistant1passwordless1zero-trust1decentralized1homomorphic encryption1identity protection1department of defense1enterprise security1data security1somerville1secure ai1femtosecond laser1glaucoma1ophthalmology1noninvasive surgery1trabecular meshwork1image-guided laser1open-angle glaucoma1eye care1vialuxe1flight procedure1aliso viejo1intraocular pressure1viam1physical world ai1iot1robotics software platform1hardware-agnostic1open source robotics1data platform1smart machines1eliot horowitz1mongodb founder1predictive maintenance1ctv advertising1connected tv1streaming ads1ad tech1performance marketing1ai advertising1self-serve ad platform1ott advertising1media buying1tv advertising1generative ai creative1marketing software1smb advertising1computational biology1t-cell engager1masked antibody1prodrug1protein engineering1multi-specific antibodies1logic-gated therapeutics1ai drug design1dystonia1parkinsons-disease1movement-disorders1muscarinic-receptor1oral-therapy1orphan-drug1vim04231atlas-venture1fda-fast-track1diabetes-reversal1type-2-diabetes1digital-health1continuous-remote-care1weight-loss1nutritional-ketosis1health-coaching1remote-monitoring1value-based-care1employer-benefits1health-plans1chronic-disease-management1ai-healthcare1behavioral-science1denver1data visualization1visual analytics1flaremap1treemaps1big data1operational visualization1risk management1threat assessment1anomaly detection1fraud detection1defense intelligence1decision support1geospatial visualization1performance monitoring1collaborative intelligence1healthcare ai1patient experience1emergency department software1edis1llm healthcare1fhir hl71hcahps1hospital software1discharge instructions1medical translation1hitrust1patient navigator1lab-grown human organs1organ-on-a-chip1preclinical testing1animal testing replacement1human tissue engineering1predictive ai1toxicity prediction1pharma1organoids1clinical trial failure1high throughput screening1battery intelligence1battery analytics1electric vehicles1battery data management1manufacturing analytics1quality control1battery safety1data infrastructure1lithium-ion1battery testing1valuation1fairness opinions1solvency opinions1mergers and acquisitions1private equity1financial reporting1tax valuation1intangible assets1complex securities1portfolio valuation1independent valuation1corporate finance1kidney disease1monoclonal antibody1supar1podocytes1dynamin1chronic kidney disease1ckd1fsgs1proteinuria1renal1nephrology1rare disease1cambridge biotech1wal09211disease-modifying medicines1waldo1agentic brand intelligence1ai marketing1brand strategy1social listening1competitive intelligence1advertising agencies1marketing research1new orleans startup1justin wohlstadter1strategy engine1trend analysis1audience insights1uav1heavy-weather1vtol1evtol1isr1search-and-rescue1law-enforcement1unmanned-aircraft1connecticut1made-in-usa1all-weather1turbojet1k-121social-emotional learning1sel1curriculum1future-ready skills1durable skills1mtss1purpose-driven learning1student wellbeing1school districts1career readiness1belonging1casel-aligned1portrait of a graduate1life readiness1vr baseball training1softball training1virtual reality1meta quest1ai swing analysis1pitch recognition1sports technology1athlete development1swingai1trainvr1blast motion1austin startup1mlb training1youth baseball1smartpark1air conditioner1window ac1air purifier1smart air care1hepa filter1smart home1consumer products1energy efficient1air quality1whispertech1sustainable1fans1contractor payments11099 filing1payroll platform1contractor management1embedded fintech1w-9 verification1payables automation1tax compliance1freelancer benefits1instant payouts1api-first1white-label1background checks1independent contractors1nemt1non-emergency medical transportation1rideshare1healthcare transportation1ground transportation1medicaid transportation1credentialed drivers1patient transport1tnc1peer-to-peer rides1scheduled rides1no surge pricing1vulnerable populations1atlanta1driver platform1fan engagement1gamification1sports marketing1first-party data1digital activation1contests1sweepstakes1vote-to-win1fan maps1predictive gaming1lead generation1marketing technology1sponsor fulfillment1nfl1nhl1nba1mls1sports tech1real estate1commercial real estate1lease-to-own1small business1property ownership1smb1community ownership1displacement prevention1new york1real estate platform1ownership platform1neighborhood revitalization1how-to videos1instructional content1tech tutorials1gadget hacks1null byte1white hat hacking1augmented reality1mixed reality1diy1online media1consumer internet1video aggregation1smartphones1food hacks1santa monica1allogeneic car-t1off-the-shelf cell therapy1memory nk cells1cancer immunotherapy1t-cell malignancies1t-all1t-lbl1aml1crispr gene editing1clinical-stage biotech1wu-cart-0071soficabtagene geleucel1wu-nk-1011regenerative medicine1st louis biotech1washington university spinout1endovascular robotics1medical robotics1neurovascular care1stroke treatment1telerobotic surgery1steerable guidewire1mechanical thrombectomy1brain aneurysm1minimally invasive surgery1surgical robotics1houston medtech1iris robotic system1electrosteer guidewire1remote surgery1satellite navigation1pnt1gps alternative1leo constellation1pulsar1positioning navigation timing1anti-jamming1anti-spoofing1space technology1centimeter accuracy1resilient pnt1low earth orbit1gnss1autonomous vehicles1pallet1logistics1freight1copallet1atlas1freight brokerage1back-office automation1ai workforce1san francisco startup1bain capital ventures1nft1no-code1loyalty programs1rewards13d virtual stores1interoperability1nft loyalty1creator tools1content management1brand engagement1open innovation1technology scouting1innovation consulting1technology transfer1technology licensing1intellectual property1patent acquisition1open innovation portals1innovation intermediary1r&d collaboration1technology marketplace1crowdsourcing challenges1innovation strategy1due diligence1b2b consulting1waltham massachusetts1mobile car care1vehicle inspection1ev charging1preventative maintenance1automotive services1virtual inspection1mobile ev charging1fleet compliance1ai computer vision1on-demand car services1nashville startup1rideshare services1tire services13d fashion1digital fashion1garment simulation13d cad1virtual try-on1z-weave1cloth simulation1fashion tech13d design1digital transformation1unreal engine1maya plugin1seoul startup1b2b software1single-cell1high-throughput-screening1microfluidics1nanofabrication1z-screen1active-seq1tcr-discovery1perturbation-biology1life-sciences1cell-based-assays1rna-binding-proteins1autoimmune1immunology1thymus1type-1-diabetes1tolerance1regulatory-t-cells1tregs1bifunctional-antibodies1polaris-partners1central-tolerance1geothermal1ai exploration1carbon-free power1geoscience1subsurface modeling1geothermal discovery1energy startup1salt lake city1utah1baseload power1blind geothermal1ai data analyst1conversational analytics1semantic layer1self-serve bi1natural language queries1data governance1embedded analytics1large language models1snowflake1bigquery1databricks1dbt integration1zoe ai1data modeling1metrics layer1thermal energy storage1tes1industrial heat1decarbonization1heat-as-a-service1clean heat1industrial steam1off-peak electricity1charleston1south carolina1project development1energy transition1crypto infrastructure1stablecoin1tokenization1embedded finance1crypto api1custody1on-off ramp1payments1settlement1regulated crypto1b2b fintech1qualified custody1kids social media1safe social network1coppa certified1kidsafe1video challenges1child safety1content moderation1gen alpha1gen z1e-learning1digital citizenship1human moderated1celebrity creators1parental consent1doctor booking1appointment scheduling1health tech1medical marketplace1insurance verification1provider directory1online scheduling1real-time availability1dental booking1ai voice assistant1surgical coordination1surgical scheduling1health it1ai in surgery1episode of care1ambulatory surgery centers1surgical inventory management1physician workflow1orthopedics1patient readiness1case management1intelligent scheduler1neoantigen1personalized cancer vaccine1dna vaccine1hepatocellular carcinoma1gt-epic platform1electroporation1il-12 adjuvant1tumor infiltrating lymphocytes1biotherapeutics1fiber1nutrition1food-tech1ingredients1oligosaccharides1uc-davis-spinout1functional-food1gut-health1sacramento1plant-fiber1food-science1delivery management1route optimization1dispatch automation1logistics software1delivery tracking1proof of delivery1driver app1real-time tracking1delivery api1courier software1predictive etas1fusion energy1muon-catalyzed fusion1nuclear fusion1muon source1accelerator technology1deuterium-tritium1arpa-e1low temperature fusion1power generation1hard tech1bipolar lead battery1greenseal1evergreenseal1long-duration energy storage1grid storage1clean technology1lead-acid battery1battery manufacturing1recyclable batteries1michigan manufacturing1non-flammable battery1stationary storage1radiopharmaceuticals1targeted alpha therapy1lead-2121212pb1cancer treatment1isotope manufacturing1radioligand therapy1prostate cancer1nuclear medicine1theranostics1alpha isotope generator1biopharmaceuticals1semi-private aviation1private jet1luxury travel1book-by-the-seat1embraer jets1aviation1airlines1travel1van nuys1aspen1los cabos1charter flights1premium travel1garrett camp1expa1agritech1precision agriculture1drone data1yield forecasting1crop analytics1fruit sizing1tree health1aerial imagery1remote sensing1ai for agriculture1smart farming1crop monitoring1south africa startup1data analytics1product management1product roadmap1roadmap software1product strategy1agile development1idea management1product discovery1knowledge base1whiteboards1bootstrapped1remote-first1ai assistant1feature prioritization1customer feedback1minimum lovable product1cancer1car-t-engagers1clinical-trials1aleta-0011blood-cancer1lymphoma1cd191cd201relapse1natick-massachusetts1cancer-research-uk1engager-proteins1monoclonal antibodies1bispecific antibodies1transgenic mice1tcr discovery1genetic medicines1venture studio1cro1biotechnology research1antibody engineering1targeted therapeutics1programmable medicines1and-body1drug delivery1computational drug design1immuno-inflammation1flagship pioneering1boston biotech1autonomous mobile robots1amr1agv1material handling1robots-as-a-service1manufacturing automation1bengaluru startup1ai robotics1intralogistics1pallet robots1factory automation1nuclear1microreactor1micro-fission1triso fuel1space1advanced reactor1sodium heat pipes1department of energy1torrance1energy resilience1electric boats1electric propulsion1wake boat1marine technology1ev boats1battery1zero emissions1watersports1arc sport1arc one1arc coast1spacex alum1rivian alum1tesla alum1electric tugboats1maritime1sustainable boating1over-the-air updates1vertical integration1active-protection-system1iron-curtain1sentinel1rpg-defense1vehicle-protection1embedded-systems1sensors1fpga1asic1edge-computing1us-army1highway-safety1digital-armor1herndon-virginia1real-time-systems1military-hardware1security robots1dronedog1robotics-as-a-service1perimeter security1physical security1ground robotics1ai security1bvlos1thermal imaging1logistics security1boston dynamics spot1robotic security operations center1us-made robotics1surveillance1client onboarding1client servicing1wealth management1agentic workflows1knowledge graph1ai operating system1relationship intelligence1workflow automation1rias1asset management1insurance13d-printing1harp-technology1high-area-rapid-printing1large-format-3d-printing1industrial-3d-printers1stereolithography1lake-printer1northwestern-university-spinout1advanced-manufacturing1industrial-machinery1resin-printing1materials-development1deep-tech1b2b-manufacturing1healthcare it1telepresence robots1patient self-service1patient intake automation1patient kiosks1remote healthcare access1virtual field trips1veterans affairs1queuing and check-in1low-resource connectivity1robot as a service1vecna1b-inc1burlington massachusetts1women-led13d modeling1cad1mesh to cad1scan to cad1text to 3d1idea to mesh1parametric cad1additive manufacturing13d printing1product design1solidworks plugin1onshape1manufacturing software1markforged founders1utilities1grid-management1africa1smart-metering1energy-analytics1power-distribution1outage-management1data-analytics1clean-energy1energy-tech1solar1lagos1nigeria1digital-grid1property management1rental homes1guaranteed rent1tenant screening1homeowners1residents1ai pricing1single-family rentals1miami1venture backed1rental platform1tech-enabled property management1live-biotherapeutics1gut-brain-axis1epilepsy1dravet-syndrome1als1ketogenic1irisrx1bl-0011synthetic-biology1rare-disease1pharmaceuticals1cns1brain disorders1neuropsychiatry1schizophrenia1bipolar disorder1depression1medicinal chemistry1waltham1massachusetts1first-in-class1construction fintech1b2b payments1bnpl1net terms1trade credit1invoice financing1factoring1accounts receivable1lines of credit1building materials1contractors1lbm suppliers1cash flow1payment portal1credit decisioning1construction payments1digital payments1boxbot1supply chain automation1parcel handling1automated storage1dynamic storage1logistics technology1ai logistics1conveyor automation1alameda startup1industrial robotics1cross dock1bonded storage1sortation1meditation1sleep1mindfulness1mental health1sleep stories1meditation app1anxiety relief1stress management1calm business1calm health1guided meditation1soundscapes1consumer subscription1b2b wellness1corporate wellness1self-care1mobile app1ff&e1interior design software1furniture1design tools1ai design1space planning1mood boards1product schedules1sustainable design1architecture1design collaboration1browser-based design1furniture marketplace1low-carbon offices1wedding marketplace1wedding planning1wedding vendors1venue finder1real wedding galleries1wedding inspiration1hospitality fintech1digital invoicing1revenue optimization1events industry1marketing platform1vendor directory1roh1humidifier1stainless steel humidifier1filter-free humidifier1sterilizable humidifier1home health1air hydration1doctor-designed1cool mist1warm mist1ultrasonic humidifier1baby-safe1mold-resistant1heat sanitization1dtc1consumer goods1clean air1carepod cube1carepod one1auto refinance1car loan refinancing1auto insurance1consumer finance1auto finance1lending marketplace1denver fintech1motorefi1car payment savings1vehicle protection1digital finance1credit union lending1personal finance1vehicle logistics1car shipping1auto transport1fleet shipping1auto auctions1dealership logistics1oem shipping1ev shipping1atlanta startup1logistics marketplace1auto haulers1finished vehicle logistics1transportation tech1data foundry1enterprise ai1ai data annotation1rlhf1human-in-the-loop1ai governance1responsible ai1ai localization1nvidia partner1ai infrastructure1data marketplace1model evaluation1ai safety1physical ai1redmond1defense-tech1counter-drone1radar1sensing1threat-detection1coherent-distributed-networks1national-security1los-angeles1time-synchronization1border-security1air-defense1women in leadership1executive network1c-suite1professional community1executive coaching1leadership development1peer groups1membership network1women executives1mentorship1diversity equity inclusion1senior women leaders1career growth1networking1crypto threat intelligence1off-chain intelligence1osint1cyber threat intelligence1crypto fraud detection1blockchain investigations1crypto kyc1market manipulation detection1pig butchering scams1pump-and-dump detection1threat actor attribution1financial crime1regulatory compliance1ai data classification1national security1computer & network security1mobile advertising1ai-native1supply-side platform1ssp1programmatic1monetization as code1trusted execution environment1mobile publishers1ad monetization1mopub1max1composting1food waste recycling1organics recycling1food scrap collection1zero waste1soil health1sustainability1waste diversion1regenerative soil1compost outpost1dmv composting1maryland1rockville1environmental services1landfill reduction1curbside composting1farm feast1warehouse drones1embodied ai1cycle counting1lights-out warehouse1cold chain1logistics tech1barcode scanning1industry 4.01cancer-immunotherapy1tcr-mimetic-antibodies1t-cell-engagers1antibody-engineering1myeloid-leukemia1t-bolt-platform1cbx-2501phla-targeting1meat delivery1craft beef1wagyu1direct to consumer1food transparency1grass fed1seafood1subscription box1seattle startup1ethical farming1sustainable food1ranchers1online butcher1food ecommerce1japanese a5 wagyu1digital shelves1hospital logistics1health-tech1predictive analytics1digital twin1ptz cameras1auto-replenishment1demand planning1asset tracking1real-time inventory1houston1hamburg1market data1market data api1financial data1algorithmic trading1high-frequency trading1quant trading1historical market data1real-time data feeds1full order book1pay-as-you-go1cloud-native1trading infrastructure1exchange data1data api1gpu cloud1serverless gpu1llm api1machine learning infrastructure1open source models1openai-compatible api1model hosting1low latency inference1pay-per-use1deep learning1ml infrastructure1dedicated gpu1nvidia blackwell1ai cloud1ai4s1quantum chemistry1materials discovery1catalysis1reactiveai1high-throughput experimentation1machine learning force fields1graph neural networks1dft1chemistry ai1mit spinout1energy materials1scientific computing1compliance automation1soc 21hipaa1gdpr1iso 270011regtech1security compliance1trust management1audit automation1fedramp1pci-dss1regenerative-medicine1tissue-therapeutics13d-bioprinting1biomaterials1liver-failure1medical-device1bionidum1northwestern-spinout1chicago-biotech1regenerative-therapeutics1implantable-therapies1vascularization1social engineering defense1brand protection1digital risk protection1phishing response1executive protection1anti-phishing1ai-native security1threat intelligence1impersonation detection1takedown automation1human risk management1deepfake monitoring1email security1luxury cars1exotic cars1supercars1luxury automotive marketplace1classic cars1luxury lifestyle1car magazine1high-net-worth1yachts1luxury real estate1exotic car finance1automotive media1digital marketplace1luxury advertising1clearwater florida1clinical research ai1medical chart review1clinical trial recruitment1synapsis ai1patient finder1emr automation1large language models healthcare1hipaa compliant ai1real-world data1registry reporting1observational studies1healthcare data1on-premise ai1ai research assistant1systematic review1literature review automation1evidence synthesis1meta-analysis1data extraction1scientific research1health economics1clinical trials1pubmed1research productivity1pharma research1prisma 20201ai reading coach1child literacy1speech recognition1phonics1decodable books1early childhood education1science of reading1kids reading app1adaptive learning1voice ai1read with ello1k-3 literacy1reading tutor1analog in-memory computing1ai accelerator1edge ai1on-device ai1ai chip1semiconductor1low power ai1energy efficient ai1charge-domain computation1en1001client computing1princeton spinout1generative ai hardware1smartphone vision test1at-home eye exam1vision care1refraction measurement1eyeglass numbers1consumer electronics1optometry1pupillary distance1ai vision1remote monitoring1mit technology1insurance commission software1insurtech1commission management1commission reconciliation1revenue operations1payout automation1ai data extraction1insurance agencies1brokerages1producer portal1financial back office1revenue recovery1life and annuity1property and casualty1employee benefits1jet lag1travel health1flykitt1fount1circadian rhythm1inflammation1supplements1blue light glasses1navy seals1ai travel app1sleep optimization1travel recovery1andrew herr1d2c wellness1
Often tagged with
Showing 30 results for customer-experience
Sort:
FUNDED!
Freshworks
F
San Mateo
CompanySaasEnterprise
Freshworks

Freshworks is a cloud-based business software company that builds easy-to-use customer service, IT service management and CRM tools for companies that found legacy enterprise software too complicated and too expensive. Founded in Chennai in 2010 as Freshdesk, it became the first India-born SaaS company to list on Nasdaq in 2021 and now serves tens of thousands of customers worldwide with an AI assistant, Freddy, woven through its products.

2010Founded
San MateoHQ
$1.03BIPO (Nasdaq: FRSH)
saascustomer-service-softwareitsmcrmhelpdeskfreddy-ai
FUNDED!
John Paul
JP
Paris
CompanySaasEnterprise
John Paul

John Paul is a Paris-based premium concierge and customer-loyalty company that operates white-label services for luxury brands and enterprises. Founded in 2007-2008 by David Amsellem, it pairs human concierges with a proprietary CRM platform to manage the relationships brands have with their most valuable clients and employees. After merging with US rival LesConcierges in 2015, it was acquired by AccorHotels in 2016 and now runs as a business accelerator inside the Accor group, serving clients such as Visa, Hyundai, Orange and luxury houses across automotive, finance, fashion and travel.

2007Founded
ParisHQ
~US$150 million valuationAcquisition
conciergeluxurycustomer-loyaltycrmemployee-engagementpremium-customer-relationship
FUNDED!
Webex
W
San Jose
CompanySaasEnterprise
Webex

Webex is the collaboration platform born from one of the web's first conferencing companies and now run by Cisco. It bundles meetings, calling, messaging, webinars, contact center, and a line of conference-room hardware into a single suite, layered with AI for transcription, real-time translation across dozens of languages, and agent assistance. It serves enterprises, governments, schools, and hospitals that need secure, large-scale communication for distributed teams.

1995Founded
San JoseHQ
$3.2BAcquisition
video-conferencingweb-conferencingonline-meetingsteam-collaborationcloud-callingcontact-center
LEGEND!
Ashraf Karim
AK
PersonExecutiveOperator
Ashraf Karim

Ashraf Karim is Senior Vice President of Connected Customer Experiences & Technology at ServiceNow, where he leads the charge on transforming how enterprises engage customers through AI-powered digital workflows. With over two decades spanning engineering, product management, and executive leadership at Google, PayPal, Affirm, and Cisco, Karim bridges the gap between deep technical fluency and strategic business thinking. He is known for championing simplicity-first design, advocating that reducing cognitive load at every customer touchpoint is the defining discipline of great product leadership.

servicenowsvpproduct-managementcustomer-experienceenterprise-softwareai
FUNDED!
Oracle Sales Cloud
OS
Austin
CompanySaasEnterprise
Oracle Sales Cloud

Oracle Sales Cloud (CX Sales) is Oracle's enterprise-grade cloud CRM platform that combines sales automation, AI-driven forecasting, configure-price-quote (CPQ), and subscription management into a single suite. Built on Oracle Fusion Cloud, it connects directly with Oracle ERP and supply chain data, letting sales teams quote accurately, close faster, and forecast confidently - without the integration tax that plagues competing platforms. With 5,500+ enterprise customers and $57.4 billion in annual parent revenue, Oracle Sales Cloud targets large organizations that demand reliability, data depth, and AI at scale.

1977Founded
AustinHQ
crmsales-automationenterprise-softwarecloud-computingaicpq
FUNDED!
ActiveCampaign
A
Chicago
CompanySaasAi
ActiveCampaign

ActiveCampaign is a Chicago-based marketing automation platform that helps over 180,000 businesses in 170+ countries connect with their customers through email marketing, CRM, SMS, and AI-powered automation. Founded in 2003 by Jason VandeBoom - who bootstrapped it solo for 13 years before raising $360M - the company reached a $3B valuation in 2021 and now generates $250M+ in annual recurring revenue. Its platform is particularly strong for small and mid-sized businesses that need sophisticated automation without enterprise-level complexity or cost.

2003Founded
ChicagoHQ
$240 millionSeries C
email-marketingmarketing-automationcrmsaassmall-businessai
LEGEND!
Adam Justis
AJ
PersonExecutiveOperator
Adam Justis

Adam Justis is VP of Solution Marketing & Evangelism at Adobe, where he leads go-to-market strategy for Adobe Experience Cloud. With 20+ years spanning digital advertising at Microsoft, web analytics at Omniture, and more than a decade at Adobe, he sits at the intersection of AI, personalization, and customer experience. He is a speaker at Adobe Summit, an instructor at UC Irvine's Digital Marketing Certification Program, and a prolific author on Adobe's business blog. Based in Sandy, Utah, he is one of the faces Adobe puts in front of enterprise marketers to explain what modern customer experience looks like.

adobedigital-marketingcustomer-experienceaipersonalizationsolution-marketing
LEGEND!
David Tokheim
DT
PersonExecutiveOperator
David Tokheim

David Tokheim is a senior executive at Adobe where he has served since 2013, most recently elevated to SVP, CXO Americas Industry and Canadian Sales (April 2026). Previously VP of Experience Cloud leading the Media & Entertainment, Communications, and Travel/Hospitality verticals, he has spent his career at the intersection of digital media, advertising technology, and enterprise software. Before Adobe, he was EVP & GM at Six Apart Media (growing its blog audience to 220 million monthly uniques), SVP at Fox Interactive Media overseeing monetization across MySpace and IGN, and VP of Marketing at IGN Entertainment where he built strategic programs for brands like Pepsi, EA, and Walmart. A UCLA English grad turned ad-tech veteran, he champions AI-driven personalization and content velocity as the defining imperatives of modern customer experience.

adobeexperience-cloudmedia-entertainmentdigital-marketingsaasenterprise-sales
LEGEND!
Devasena Rajamohan
DR
PersonExecutiveEngineer
Devasena Rajamohan

Devasena Rajamohan is Corporate Vice President of Dynamics 365 Customer Experience Applications at Microsoft, leading global teams of product managers, engineers, and data scientists driving innovation across Customer Insights, Sales, Customer Service, and Copilot. With a career spanning over two decades in enterprise CRM and cloud software—including senior leadership at SAP and early engineering roles at TATA Infotech—she has shaped how large organizations deliver AI-powered customer engagement. Under her leadership, Microsoft earned recognition as a Leader in both the 2025 Gartner Magic Quadrant for CRM Customer Engagement Center and The Forrester Wave Customer Service Solutions Q1 2026.

microsoftdynamics-365crmcustomer-experiencecorporate-vice-presidententerprise-software
LEGEND!
Duncan Egan
DE
PersonExecutiveOperator
Duncan Egan

Duncan Egan is Vice President of Enterprise Marketing at Adobe, leading the Digital Experience business across Asia Pacific and Japan from Sydney. A Silicon Valley transplant who grew up near Adobe's founders, he has spent 25+ years driving marketing-led growth at enterprise software companies including ServiceNow, Oracle, Taleo, and TIBCO - helping build the playbook for B2B marketing in the Asia-Pacific region before the rest of the world caught up.

adobeenterprise-marketingapacb2b-marketingdigital-experiencegenerative-ai
LEGEND!
JB
PersonExecutiveOperator
Jennifer Burke

Jennifer Burke is an Area Vice President for Digital Experience in the Media & Entertainment vertical at Adobe, where she leads enterprise sales and customer engagement for one of the company's most competitive industry segments. Based in Gainesville, Georgia, she brings over three decades of high-stakes commercial experience spanning retail, CPG, and enterprise technology - from rising through Catalina USA's brand development ranks to closing strategic accounts at Microsoft before joining Adobe's go-to-market machine. She is currently at the sharp edge of Adobe's push into agentic AI, championing AI-driven customer experience products to some of the largest media and entertainment companies in the world.

adobedigital-experiencemedia-entertainmentvice-presidentmarketingagentic-ai
LEGEND!
Mala Anand
MA
PersonExecutiveOperator
Mala Anand

Mala Anand is Executive Vice President and Chief Customer Experience Officer at Microsoft, leading the Customer Experience & Success division. A 25-year technology veteran who immigrated from Mumbai at 17 on a Rotary Youth Exchange Scholarship, she has shaped enterprise software at Cisco, SAP, and Microsoft, driving AI-powered transformations that measurably improve how customers get support. She is also executive sponsor of Women at Microsoft and an independent board director at Agilent Technologies.

microsoftcustomer-experienceaienterprise-softwarewomen-in-techcloud
LEGEND!
Matt Lombardi
ML
PersonExecutiveOperator
Matt Lombardi

Matt Lombardi is the Global Vice President of Customer Experience at ServiceNow, where he leads the company's CX strategy for one of enterprise software's fastest-growing platforms. With over 17 years in business management and 9+ years specializing in customer experience, he has built and scaled CX programs across Fortune 500 companies including ADP and SAP Concur. In 2025, he was named to the Forbes World's Most Influential CMOs list, recognized for his work connecting customer satisfaction metrics directly to retention and revenue growth.

customer-experienceservicenowenterprise-softwarecx-leadershipsaasb2b
LEGEND!
Nicholas Kontopoulos
NK
PersonExecutiveOperator
Nicholas Kontopoulos

Nicholas Kontopoulos is the Vice President of Marketing for Asia Pacific & Japan at Twilio, the cloud communications platform. Based in Singapore, he brings over 30 years of marketing and business leadership experience across APAC, with prior senior roles at Adobe (DX), SAP, Magento, and Capita. A recognized thought leader in customer experience and AI-driven marketing, he is a frequent speaker, published author, and LinkedIn Power Profile holder known for challenging marketing orthodoxy across the region.

marketingapacjapansingaporetwiliocustomer-experience
LEGEND!
Dennis Fois
DF
PersonExecutiveOperator
Dennis Fois

Dennis Fois is the CEO of Bloomerang, the leading nonprofit donor management and CRM platform serving over 26,000 organizations across North America. With more than 25 years of international leadership in CRM and customer experience technology - spanning roles at Copper CRM, NewVoiceMedia (sold to Vonage for $350M), Rant & Rave, eGain, Barclays, and ADP - Fois brings a rare combination of high-growth SaaS playbook execution and genuine conviction about the nonprofit sector's transformative potential. Based in San Francisco, he joined Bloomerang in January 2023 to lead the company's next phase of growth, overseeing a strategic investment from Warburg Pincus in 2024 and the acquisitions of Qgiv and InitLive to build what he calls the 'First Giving Platform.'

ceobloomerangnonprofit-crmsaascrmdonor-management
LEGEND!
Dennis Woodside
DW
PersonExecutiveOperator
Dennis Woodside

Dennis Woodside is the CEO and President of Freshworks, a Nasdaq-listed SaaS company serving 75,000 customers worldwide with AI-powered business software. A Cornell rower turned Stanford lawyer turned McKinsey consultant turned tech executive, he has spent two decades building and scaling iconic companies - leading Google's EMEA sales engine, running Motorola Mobility after its $12.5B acquisition by Google, scaling Dropbox from $250M to a $1B+ IPO, and betting on plant-based food at Impossible Foods before landing at Freshworks in 2022. Off the screen, he is a 15-time Ironman Triathlon finisher who qualified for the World Championship in Kona, Hawaii.

ceosaasfreshworksenterprise-softwareaicloud
FUNDED!
Birdeye
B
Palo Alto
CompanySaasAi
Birdeye

Birdeye is a Palo Alto-based customer experience and reputation marketing platform used by more than 150,000 businesses to manage reviews, listings, surveys, messaging, and social presence. In 2025 the company repositioned itself as the first 'Agentic Marketing Platform,' launching a suite of autonomous AI agents (BirdAI) that handle reviews, social, listings, and search visibility for multi-location brands.

2012Founded
Palo AltoHQ
$60MSeries C
reputation-managementreviewscustomer-experiencelocal-seoagentic-aimulti-location
FUNDED!
Cresta
C
Sunnyvale
CompanyAiSaas
Cresta

Cresta is a generative AI platform built for the contact center, unifying human and AI agents on one system to coach reps in real time, automate post-call work, and turn millions of conversations into measurable revenue, retention, and compliance outcomes.

2017Founded
SunnyvaleHQ
$125MSeries D
aicontact-centergenerative-aiagent-assistcustomer-experiencereal-time-coaching
LEGEND!
TC
PersonExecutiveOperator
Taylor Carlson

Taylor Carlson is an Area Vice President at Adobe overseeing Customer Experience Orchestration, leading enterprise sales teams focused on AI-driven journey management and digital experience solutions. With a career arc spanning QA engineering at GameHouse to top-performing enterprise account executive at Bizible to VP leadership at Adobe, Carlson has built a reputation for closing complex enterprise deals and scaling high-performing revenue teams. Based in New York, they hold a BS in Information Science and Applied Mathematics from the University of Washington and a Certificate of Negotiation Mastery from Harvard Business School Online.

adobeenterprise-salescustomer-experiencecustomer-journeysaasmarketing-technology
FUNDED!
Narvar
N
San Mateo
CompanySaasAi
Narvar

Narvar is a San Mateo-based enterprise SaaS platform that owns the 'post-purchase' moment for retailers - the stretch between checkout and a customer's next order. Its software powers order tracking, delivery notifications, returns, exchanges and fraud prevention for 1,500+ brands including Sephora, Gap, Patagonia, Home Depot, Levi's and Sonos, and has handled billions of consumer interactions across 38+ countries.

2012Founded
San MateoHQ
$30MSeries C
post-purchaseretail-techreturns-managementorder-trackingcustomer-experiencelogistics
FUNDED!
Numa
N
Oakland
CompanyAiSaas
Numa

Numa is the leading AI platform for automotive dealerships, powering customer operations across 1,300+ rooftops in the U.S. and Canada. Founded by the team behind Location Labs (acquired by AVG for $220M), Numa's AI agents handle calls, texts, appointments, and customer satisfaction monitoring - reducing response times from 24 hours to 20 minutes and driving measurable increases in dealership profitability and CSI scores.

2017Founded
OaklandHQ
$12,100,000Earlier Rounds
aiautomotivedealershipvoice-aicustomer-servicesaas
LEGEND!
Amit Sharma
AS
PersonFounderExecutive
Amit Sharma

Amit Sharma founded Narvar in 2013 to fix the most overlooked moment in e-commerce: the anxious gap between clicking 'buy' and the package arriving at the door. Drawing on years spent optimizing supply chains at Williams-Sonoma, Walmart, and Apple, he built a post-purchase experience platform from a bootstrapped garage operation into a market leader serving 650+ retailers - including Sephora, Home Depot, LVMH, and Patagonia - before stepping back from the CEO role in October 2024 to an advisory position.

narvarpost-purchaseecommerceretailsaassupply-chain
LEGEND!
Anisa Kumar
AK
PersonExecutiveOperator
Anisa Kumar

Anisa Kumar is the CEO of Narvar, a retail technology platform serving 1,500+ global brands with AI-powered post-purchase experiences. With over 23 years across Target, Walmart.com, and Levi Strauss where she helped lead the company's IPO, she became Narvar's Chief Customer Officer in 2021 and was elevated to CEO in October 2024. Under her leadership, Narvar launched its IRIS AI engine - analyzing 42-74 billion consumer interactions annually - to transform the moment after checkout from a cost center into a growth engine.

ceoretail-techpost-purchaseecommercesaassupply-chain
LEGEND!
Clay Bavor
CB
PersonFounderExecutive
Clay Bavor

Clay Bavor is Co-Founder of Sierra, the AI customer experience company he launched in early 2023 alongside Bret Taylor. Before Sierra, Bavor spent 18 years at Google, where he rose from product manager to VP leading Google Labs — overseeing Google's AR/VR efforts (including Cardboard, Daydream, ARCore, Google Lens, and Project Starline), and before that running product and design for Gmail, Google Drive, Google Docs, and Google Workspace. Sierra has raised $1.585 billion in total funding, most recently a $950M Series E at a $15.8 billion valuation in May 2026, serving over 40% of the Fortune 50 with AI agents that resolve 50–90% of customer inquiries.

aifoundersierragooglevrar
LEGEND!
Naveen Gupta
NG
PersonFounderExecutive
Naveen Gupta

Naveen Gupta is the co-founder and CEO of Birdeye, a Palo Alto-based AI-powered customer experience platform that serves over 100,000 businesses globally. Inspired by a personal struggle to find a quality surgeon for his mother at Stanford, Naveen and his brother Neeraj built Birdeye in 2012 to help businesses manage their online reputation and grow through customer feedback. Under his leadership, Birdeye crossed $100M ARR in 2023, raised over $93M in total funding, and pioneered what Naveen calls 'Experience Marketing' - the discipline of turning customer satisfaction into organic growth. A veteran of Yahoo and RingCentral, he brings deep product and operational expertise to one of SaaS's quietest success stories.

ceobirdeyesaasreputation-managementcustomer-experienceai
LEGEND!
NS
PersonExecutiveOperator
Nehal Shaikh

Nehal Shaikh is the Chief Executive Officer (India) at Front, the customer operations platform headquartered in San Francisco. Front helps more than 8,000 companies manage customer communication across email, SMS, live chat, and other channels through shared inboxes, AI-powered automation, and real-time analytics. Backed by $338M in total funding and valued at $1.7B since its 2022 Series D, Front crossed $100M in annual recurring revenue in 2025. Based in Maharashtra, India, Shaikh leads Front's India operations as the company scales its AI-driven customer service platform globally.

ceocustomer-operationssaasfrontenterprise-softwareindia
LEGEND!
Raghu Ravinutala
RR
PersonFounderExecutive
Raghu Ravinutala

Raghu Ravinutala is the co-founder and CEO of Yellow.ai, an enterprise-grade conversational AI platform that automates customer and employee experiences at scale. A former IC design engineer turned AI entrepreneur, he built Yellow.ai into a $500M-valued company serving 1,300+ enterprises across 85+ countries, with $79.5M in annual revenue and over $102M raised. Under his leadership, Yellow.ai developed proprietary LLM technology and a multi-LLM architecture trained on 16 billion conversations annually, processing support in 135+ languages across 35+ channels.

aiconversational-aiyellow-aicustomer-service-automationsaasenterprise
LEGEND!
Romain Lapeyre
RL
PersonFounderExecutive
Romain Lapeyre

Romain Lapeyre is the Co-founder and CEO of Gorgias, the AI-powered customer experience platform built for ecommerce brands. Founded in Paris in 2015 with co-founder Alex Plugaru and later relocated to San Francisco, Gorgias has grown to serve 16,400+ merchants including Glossier, Steve Madden, and Dollar Shave Club, reaching $80M ARR with roughly 520 employees and $103M+ in total funding. Lapeyre studied at HEC Paris and has built Gorgias using a data-driven, partner-led growth model - scaling to 10,000+ customers without traditional cold calling.

gorgiasecommercesaascustomer-supportaihelpdesk
FUNDED!
Sierra
S
San Francisco
CompanyAiEnterprise
Sierra

Sierra is a San Francisco AI company building conversational agents that handle customer interactions for enterprises. Founded by Bret Taylor and Clay Bavor in 2023, it serves more than 40% of the Fortune 50 and was last valued at $15.8 billion after a $950M Series E in May 2026.

2023Founded
San FranciscoHQ
$285M (cumulative)Earlier rounds
ai-agentsconversational-aicustomer-experienceenterprise-aibret-taylorclay-bavor
LEGEND!
Tiago Paiva
TP
PersonFounderExecutive
Tiago Paiva

Tiago Paiva is the founder and CEO of Talkdesk, the AI-powered cloud contact center platform he built from a 10-day hackathon project in 2011 into a $10 billion enterprise unicorn. Born in Portugal and trained as an engineer at Instituto Superior Técnico, he packed his bags for San Francisco two weeks after winning a Twilio hackathon and never looked back. Under his leadership, Talkdesk has grown to over 2,000 employees in 16 countries, posting $420M in ARR, and pioneering agentic AI across the entire contact center stack.

talkdesksaascontact-centeraiccaascustomer-experience