Pricing
TAGS

Tagged Content

Tagged: b2b

Everything on the platform tagged with b2b.

Browse all tags
saas12machine learning11biotech9supply chain8fintech8oncology6b2b saas5cybersecurity5clinical-stage5medical devices5ai agents4artificial intelligence4logistics4mit-spinout4enterprise software4austin startup4d2c4predictive analytics4healthtech4national security4clean energy4agentic ai3san francisco3mit spinout3enterprise ai3workflow automation3edtech3data science3automation3telehealth3drug-discovery3iot3b2b3drug discovery3generative ai3deep tech3decarbonization3inventory management3ai3y combinator3digital health3precision-medicine3agentic-ai3medical-devices3machine-learning3cpg3circular economy3sustainability3developer tools2foundation models2large language models2cleantech2data centers2predictive maintenance2new york startup2freight forwarding23pl2pallet2tpm today2cargowise2drayage2tribal knowledge2journal of commerce2autonomous vehicles2logistics automation2sensor fusion2clinical research2cambridge2silicon valley2subscription2autoimmune2ai-drug-development2cell-therapy2car-t2vdi2high-performance computing2semiconductors2hypothesis generation2defense2consumer insights2market research2merchandising2back-office automation2bill pay2remote monitoring2new-york2virtual-care2digital-health2augmented reality2mixed reality2precision medicine2aiops2cloud security2crypto2mit2tms2defense tech2aerospace2defense and space2employee benefits2insurtech2benefits administration2health insurance2chicago2immuno-oncology2health tech2adas2genomics2clinical trials2physical ai2human-in-the-loop2saas-platform2subscription app2consumer internet2price optimization2drug-development2environmental services2edge ai2situational awareness2public safety2computer vision2freight2trucking2cancer-immunotherapy2climate tech29111coding agents1ai research1reasoning models1code generation1ai safety1ai unicorn1sculptor1parallel agents1human-centered ai1agi1cooling towers1water recovery1plume abatement1industrial cooling1water sustainability1power plants1ai analytics1waterpanel1towerpulse1electrostatic droplet capture1water conservation1instalily1vertical ai1ai teammates1instaworkers1distribution1erp integration1crm integration1insight partners1series a1coding bootcamp1tech education1web development1data analytics1ux ui design1career change1upskilling1reskilling1remote learning1tech talent1devops1cloud computing1global campuses1spain1miami1container tracking1digital workers1freight tech1self-driving yard trucks1theory of mind ai1yard automation1autonomous trucking1terminal tractors1fleet automation1cambridge startup1mobile security1mobile edr1spyware detection1pegasus1threat hunting1mobile forensics1byod security1ios security1android security1zero-click exploits1executive protection1threat intelligence1smishing protection1mercenary spyware1academic medical center1nonprofit health system1hospitals1philadelphia healthcare1thomas jefferson university1lehigh valley health network1neurosciences1cardiovascular care1graduate medical education1health plan1patient care1pennsylvania1job search1online community1workforce1recruiting1blue-collar jobs1talent acquisition1social networking1career resources1hiring platform1ai job matching1labor market1resume builder1juicero1cold-press juicer1connected hardware1wifi juicer1doug evans1consumer electronics1health and wellness1venture capital1kleiner perkins1google ventures1startup failure1food tech1sparkling water1organizational memory1sushanth raman1eric johnson1technical-interviewing1interviewing-cloud1hiring1hr-tech1engineering-recruitment1interview-engineers1candidate-assessment1predictive-hiring1diversity-hiring1brilliant-black-minds1ai-interviews1remote-interviews1skill-assessment1interviewing-as-a-service1small-molecule1mass-spectrometry1high-throughput-screening1suzhou1adms-platform1ep4-antagonist1preclinical1computer-aided-drug-design1first-in-class1smart-locks1access-control1oem1embedded-firmware1wifi1bluetooth1keyless-entry1smartlock-technology1pcba1cloud-platform1security1denver1colorado1interoperability1transfection1non-viral-gene-delivery1flowfect1electroporation-alternative1biomanufacturing1crispr1mrna-delivery1cell-engineering1immunotherapy1nk-cells1gmp-manufacturing1microfluidics1vector-database1multimodal-ai1lakehouse1lance-format1open-source1data-infrastructure1apache-arrow1rust1embeddings1feature-engineering1ai-training-data1hybrid-search1vector-search1y-combinator1developer-tools1connection broker1remote desktop access1virtual desktop infrastructure1hybrid cloud1zero trust security1desktop as a service1gpu virtualization1linux vdi1vendor-neutral1boston tech1work from anywhere1photonic computing1silicon photonics1optical interconnect1ai accelerator1co-packaged optics1optoelectronic computing1data center1pcie1cxl1optical network-on-chip1nanophotonics1deep learning hardware1lila sciences1scientific superintelligence1autonomous labs1ai for science1ai science factory1self-driving labs1robotic laboratories1materials science1flagship pioneering1automated experiments1green hydrogen catalysts1antibody discovery1cambridge biotech1human risk management1security awareness training1behavior change1phishing simulation1hrm platform1ai-native security1gamification1security culture1insider risk1behavioral analytics1employee training1cyber risk1raw dog food1human-grade dog food1dog nutrition1pet food1ecommerce1dog supplements1frozen raw1pet health1made in usa1dog wellness1freeze-dried treats1magnesium1critical-minerals1clean-tech1electrolysis1seawater1brine1national-security1metallurgy1light-metals1domestic-manufacturing1supply-chain1voice of consumer1product creation1retail tech1synthetic research1ai testing1assortment planning1apparel1footwear1go-to-market1digital twins1product decisions1restaurant technology1restaurant management software1invoice processing1ap automation1recipe costing1food cost control1daily p&l1foodtech1restaurant accounting1pos integrations1pots replacement1telecommunications1managed wireless1lte routers15g connectivity1life safety systems1fire alarm monitoring1enterprise connectivity1cloud platform1copper retirement1carrier agnostic1elevator phones1kitchenware1cookware1sustainable1direct-to-consumer1knives1cutting-board1recycled-plastic1japanese-steel1copper-core1non-toxic1minimalist-design1heirloom1shopify-plus1consumer-goods1amazon ppc1amazon advertising1ecommerce automation1growth automation1amazon sellers1amazon fba1bid optimization1roas1inventory optimization1advertising optimization1ems1emergency-medical-services1community-paramedicine1public-safety1mobile-integrated-healthcare1triage1care-coordination1non-emergency-call-diversion1telemedicine1healthcare-cost-reduction1civic-tech1surgical navigation1medical imaging1xr901omnifyxr1holographic navigation1interventional radiology1image-guided therapy1fda-cleared13d visualization1cleveland clinic1minimally invasive surgery1ultrasound-guided procedures1ge healthcare1ar in healthcare1cloud msp1managed services1aws partner1multi-cloud1digital transformation1cloud migration1south korea1enterprise cloud1ai-native1cloud consulting1finops1meta1meta platforms1facebook1instagram1whatsapp1messenger1threads1reality labs1metaverse1quest1ray-ban meta1smart glasses1virtual reality1llama1meta ai1open source ai1social media1digital advertising1ad tech1mark zuckerberg1menlo park1big tech1pytorch1blockchain1operational intelligence1digital asset risk management1blockchain monitoring1web31analytics1compliance1risk management1network reliability1real-time monitoring1credit building1debit card1gen z finance1ai personal finance1moneygpt1financial wellness1credit score1young adults1student finance1budgeting1no fees1no interest1financial literacy1neobank1consumer finance1immunology1inflammation1fibrosis1human-genetics1data-science1san-diego-biotech1immune-mediated-diseases1mirador3601clinical-pipeline1biopharma1azure virtual desktop1windows 3651microsoft 3651end-user computing1msp automation1cloud management1daas1microsoft intune1cloud cost optimization1nerdio manager1enterprise it1hybrid work1microsoft partner1brain science1neuromodulation1neurotechnology1pbfs1personalized brain functional sectors1depression1parkinsons1alzheimers1autism1brain mapping1neuroimaging1non-invasive1beijing1brain disorders1neuroscience1wealth-management1wealthtech1ria1financial-advisors1sequoia1ex-revolut1inhalation drug delivery1dry powder nebulizer1dryneb1respiratory therapy1lung disease1medical device1biotechnology1pulmonary medicine1high-dose lung delivery1drug delivery technology1albuquerque biotech1new mexico startup1respiratory infections1inhalation therapy device1hardware testing1mission-critical data1industrial data platform1sensor data1telemetry1edge computing1data observability1hardware-in-the-loop1test automation1dual-use1data infrastructure1engineering software1ground stations1phased array1satellite communications1space infrastructure1ground segment1el segundo1space force1satellite networks1ground network1rf hardware1space data1digital beamforming1scalable ground stations1cancer-detection1bioimpedance1cole-relaxation-frequency1point-of-care1ai-diagnostics1mohs-surgery1biopsy1surgical-margins1medtech1real-time-diagnostics1chicago-startup1marginscan1nscanary1benefits data platform1insurance technology1benefits api1carrier connectivity1benefitsos1api-first1data accuracy1enrollment automation1metal-organic-frameworks1mof1advanced-materials1chemical-separation1semiconductor1chemistry1nanotechnology1gas-storage1decontamination1precision-chemistry1materials-science1industrial-manufacturing1super-resolution microscopy1single-molecule imaging1nanoimager1life sciences1extracellular vesicles1lipid nanoparticles1drug delivery1oxford spinout1codi cloud platform1dstorm1single-molecule localization1nanoparticle analysis1scientific instruments1oral health1dental technology1smart toothbrush1intraoral imaging1teledentistry1consumer health1prophix1preventive care1dental innovation1video toothbrush1hipaa1identity security1access management1iam1identity governance1just-in-time access1least privilege1privileged access management1non-human identity1agentic ai security1policy-as-code1zero trust1access reviews13d-printing1additive-manufacturing1roll-to-roll1computational-design1metamaterials1cosmetics1micro-mesh1mass-customization1materials-foundry1polymer-development1ramp1instaswab1lumofil1digital-manufacturing1usage-based billing1billing infrastructure1revenue management1pricing1saas billing1metering1invoicing1revenue recognition1ai billing1consumption pricing1san francisco startup1autonomous-vehicles1adas-validation1automotive-ai1sensor-fusion1big-data1data-distillation1physical-ai1kpi-automation1homologation1euro-ncap1regression-testing1validation-automation1automotive-software1waltham1b2b-saas1ocean energy1wave energy1marine renewable energy1offshore power1ai data centers at sea1ocean compute1autonomous nodes1public benefit corporation1portland oregon1renewables1ai inference1deep sea energy1terawatt scale1scidb1reveal1life-sciences1multi-omics1biobank1uk-biobank1scientific-data-management1array-database1computational-biology1multimodal-data1translational-informatics1ai-validation1patient-reported outcomes1healthcare analytics1ehr integration1real-world evidence1patient engagement1biostatistics1health systems1med tech1outcomes data1chicago startups1pattern discovery1high-dimensional data1explainable ai1medical diagnostics1healthcare ai1reagent-free testing1raman spectroscopy1friday harbor1robotics1truck unloading1warehouse automation1machine vision1material handling1robotic manipulation1autonomy1distribution centers1industrial robotics1labor automation1no-code ai1nlp1model fine-tuning1content moderation1document intelligence1risk detection1customer insights1on-premise ai1data sovereignty1ai interpretability1experiential-learning1work-integrated-learning1internships1industry-projects1eportfolio1micro-credentialing1employability1higher-education1learning-analytics1ai-feedback1project-based-learning1virtual-internships1mentoring1faith app1daily prayer1bible audio1bedtime bible stories1celebrity narrators1christian community1faith-based media1prayer app1audio streaming1religious content1spiritual growth1los angeles startup1wine ai1spirits ai1beer recommendations1personalization platform1recommendation engine1b2b2c1taste matching1beverage technology1product discovery1consumer preferences1napa valley1retail personalization1sensory data1microschools1education1k-81homeschooling alternative1school choice1personalized learning1mastery-based learning1project-based learning1student-centered1guides1empowered learners1tuition-free1esa1arizona1pricing software1cpq1rebate management1ai pricing1b2b enterprise software1cloud-native saas1price management1price analytics1dynamic pricing1margin improvement1sap partner1salesforce appexchange1pricingai1retail ai1assortment optimization1demand forecasting1competitive intelligence1decision intelligence1retail analytics1pittsburgh startup1house cleaning1home services1on-demand1quick commerce1household help1india1bengaluru1gig work1domestic work1subscription cleaning1instant booking1verified professionals1women workforce1consumer app1startup1digital media1journalism1subscription newsletter1creator economy1insider news1hollywood1washington1wall street1journalist ownership1media startup1podcasts1premium content1political analysis1entertainment news1geothermal1deep-geothermal1millimeter-wave-drilling1gyrotron1clean-energy1renewable-baseload1superhot-rock1energy-transition1fusion-tech1drilling-technology1carbon-free-power1qualitative research1smart sensors1usage intelligence1ai analysis1mobile ethnography1product innovation1video insights1behavioral data1iot sensors1usesights1shopper insights1quantum network1quantum-safe communication1fiber optics1coherent optical network1quantum key distribution1qkd1midwest quantum ecosystem1indiana1infrastructure1low latency1public-private partnership1quantum computing1spend management1corporate cards1expense management1accounts payable1finance automation1ai finance1procurement1travel management1treasury1financial operations1fetal monitoring1fetal pulse oximetry1lumerah1maternal health1obstetrics1cesarean reduction1biophotonics1fda breakthrough device1noninvasive sensor1womens health1childbirth1femtech1pharmaceuticals1hdac-inhibitors1ricolinostat1diabetic-neuropathy1hdac61massachusetts1rare-disease1neuropathy1protein-acetylation1renewance1battery lifecycle management1industrial batteries1battery energy storage1bess1battery recycling1ev batteries1lithium-ion1battery stewardship1decommissioning1renewanceconnect1elmhurst illinois1probiotics1prebiotics1postbiotics1gut health1microbiome1gut-lung axis1gut-x axis1lung health1dietary supplements1physician developed1science backed supplements1metabolic health1respiratory health1transcription1captions1subtitles1speech-to-text1asr1automatic-speech-recognition1legal-tech1diarization1reverb1rev-ai1freelance-marketplace1remote-work1accessibility1api1deposition-summaries1ediscovery1meeting-notes1enterprise-speech-api1defense technology1tactical edge1geospatial intelligence1biometrics1offline intelligence1military software1drone mapping1uas data processing1decision dominance1veteran-founded1revenue intelligence1sales engagement1guided selling1salesforce-native1sales analytics1revenue operations1ai sales assistant1pipeline management1sales forecasting1activity capture1crm automation1sales enablement1deal intelligence1generative signals1enterprise-ai1legacy-modernization1business-logic1digital-transformation1logic-graph1universal-application-notation1koch-disruptive-technologies1washington-dc1technical-debt1application-development1system-of-record1motorcycle rental1peer-to-peer1motorcycle sharing1marketplace1harley rentals1motorsport1sharing economy1insurance1roadside assistance1rider pass1two-wheel mobility1travel1sleep1sleep tracker1energy1circadian rhythm1sleep debt1wellness1productivity1chronobiology1mobile app1performance1non-emergency medical transportation1nemt1healthcare transportation1medicaid1medicare advantage1patient access1health equity1social determinants of health1fleet management1ride scheduling1healthcare logistics1san antonio1care access1mobility management1space domain awareness1space situational awareness1sda sensors1satellite sensors1autonomy software1edge processing1rendezvous proximity operations1space debris1orbital intelligence1leo geo sensors1space safety1us space force1blue origin1national security space1wearable ultrasound1noninvasive neuromodulation1bioelectronic medicine1anti-inflammatory therapy1rheumatoid arthritis1low-intensity focused ultrasound1splenic ultrasound1bio-ultrasonic medicine1long covid1chronic inflammation1drug-free therapy1minneapolis medtech1darpa funded1series a startup1stablecoins1cross-border-payments1remittances1eusd1self-custodial-wallet1mobilecoin1p2p-payments1mobile-payments1freelancer-payments1sentz-earn1digital-dollar1global-payments1transportation management1ai in logistics1real-time visibility1freight automation1shipping1supply chain visibility1il-181engineered-cytokines1decoy-resistant-il-181solid-tumors1directed-evolution1new-haven1yale-spinout1small business1payroll integration1online insurance quotes1medical dental vision1brokers1smb1engagement-as-a-service1edge-computing1smart-mesh1behavior-intelligence1predictive-analytics1white-label-apps1seattle-startup1aws-co-founder1rapid-application-development1smart-stadiums1retail-iot1dispatch1owner-operators1small-fleets1load-board1ai-dispatch1trucking-software1fuel-card1route-optimization1spot-market1miami-startup1transportation1solar panel recycling1solar glass manufacturing1materials recovery1renewable energy1solar waste1end-of-life solar1domestic supply chain1satellite communication1mesh networking1atak plugin1edge networking1tactical communications1jadc21off-grid1blue uas1software-defined network1satcom1first responders1telesurgery1remote-surgery1robotic-surgery1surgical-robotics1health-tech1low-latency1healthcare-it1surgical-access1santa-barbara1series-b1food waste1surplus inventory1liquidation1managed marketplace1food recovery1waste diversion1perishables1pricing intelligence1secondary market1no-code1llm orchestration1agent builder1rag1enterprise search1ai governance1soc 21document processing1asana acquisition1rna epigenetics1epitranscriptomics1mettl3 inhibitor1stc-151cambridge uk1rna modifications1small molecule1cancer therapeutics1mass spectrometry1mrna1programmable-mrna1synthetic-biology1rna-therapeutics1il-121self-replicating-mrna1genetic-medicine1gene-circuits1cambridge-biotech1mlops1ai operations1model deployment1defense ai1model monitoring1data lineage1model governance1responsible ai1chariot platform1automatic target recognition1austin texas1model drift1ml lifecycle1b2b software1metal recycling1swarf recycling1clean industry1metal manufacturing1co2-free recycling1on-site recycling1industrial decarbonization1aluminum recycling1steel recycling1venus-l61electromagnetic heating1surgical quality1second opinion1surgeon outcomes1ai in surgery1ambulatory surgery1employer benefits1medical records1risk-adjusted outcomes1surgigpt1healthcare1rockville maryland1no-code analytics1augmented analytics1conversational ai1manufacturing intelligence1industrial ai1digital twin1jarvix1automl1business intelligence1industry 4.01factory analytics1data integration1ev financing1climate1electric vehicles1auto loans1embedded lending1credit unions1lending-as-a-service1ev finance1auto finance1terahertz1automotive sensors1all-weather radar1lidar alternative1solid-state sensor14d imaging1vehicle safety1boston startup1silicon chip1self-driving1
Often tagged with
Showing 30 results for b2b
Sort:
FUNDED!
KoreLock
K
Denver
CompanyHardwareEnterprise
KoreLock

KoreLock is a Denver-based IoT smart lock technology company that gives lock manufacturers and access control providers a turnkey, patented platform - embedded firmware, custom PCBAs, mobile and web apps, and cloud APIs - to turn ordinary offline locks into Wi-Fi and Bluetooth connected devices. Rather than competing with lock makers or software companies, KoreLock positions itself as the interoperability bridge between hardware and access control software, with technology already embedded in tens of thousands of devices across 65+ countries.

2022Founded
DenverHQ
Undisclosed (reported ~$3M)Series A
iotsmart-locksaccess-controloemembedded-firmwarewifi
FUNDED!
MarketSpark, Inc.
MI
Bannockburn
CompanyEnterpriseSaas
MarketSpark, Inc.

MarketSpark is a Bannockburn, Illinois company that replaces aging copper phone lines (POTS) for large enterprises with a managed, carrier-agnostic wireless service. As traditional carriers decommission their analog networks, MarketSpark keeps fire alarms, elevator phones, fax lines, alarm panels and voice lines working using cloud-managed 4G LTE/5G hardware, real-time monitoring and remote diagnostics - serving hundreds of America's largest enterprises across tens of thousands of locations.

2017Founded
BannockburnHQ
$7,000,000Series B
pots replacementtelecommunicationsmanaged wirelesslte routers5g connectivitylife safety systems
FUNDED!
Ramp
R
New York
CompanyFintechAi
Ramp

Ramp is a finance operations platform that combines corporate cards, expense management, bill pay, procurement, travel, treasury and accounting automation into one system. Built to save businesses time and money, it uses AI to cut manual finance work, enforce spend controls, and surface savings. Founded in 2019 by Harvard friends Eric Glyman, Karim Atiyeh and Gene Lee, Ramp serves 70,000+ organizations and reached a $44B valuation in June 2026.

2019Founded
New YorkHQ
$2.8B+ cumulativePrior rounds (Seed through Series E)
spend managementcorporate cardsexpense managementbill payaccounts payablefinance automation
FUNDED!
Terra AI
TA
Palo Alto
CompanyAiClimate
Terra AI

Terra AI is a Palo Alto geoscience company building generative AI that turns the messy, expensive guesswork of subsurface exploration into fast, probabilistic 3D models of what lies underground. By fusing geophysics, geochemistry, and drilling data, its platform generates millions of geological scenarios in minutes, helping mining and energy teams decide where to drill, how many wells they need, and whether a project is worth the capital - shrinking exploration timelines and pointing capital at the critical minerals the clean-energy transition depends on.

2023Founded
Palo AltoHQ
$20MSeries A
aigeosciencemineral-explorationsubsurface-modelinggenerative-aicritical-minerals
LEGEND!
Paul Meinshausen
PM
PersonFounderExecutive
Paul Meinshausen

Paul Meinshausen is the CEO and co-founder of Aampe, a San Francisco company that deploys agentic AI infrastructure so consumer apps can learn from each user's behavior and adapt their messaging in real time. An anthropologist turned data scientist who started his career in US Army Intelligence, he co-founded the Indian fintech PaySense (acquired by PayU for $185M) before building Aampe with collaborators he first met in a military analysis unit. He argues that businesses win not by understanding the past but by making better decisions about the future, and that personalization should be about responsiveness rather than prediction.

aampeagentic aipersonalizationdata sciencemachine learningsaas
FUNDED!
Actively AI
AA
New York
CompanyAiSaas
Actively AI

Actively AI is a New York-based enterprise software company building Intelligence-Led Revenue: custom reasoning models and Per-Account AI agents that work 24/7 to research accounts, identify high-value opportunities, and guide go-to-market teams on the next best move. Founded in 2022 by Stanford AI researchers Mihir Garimella and Anshul Gupta, it pitches a sharper alternative to the 'spray and pray' automation of earlier AI sales tools, and counts Samsara, Ramp, Ironclad, Attentive, and Verkada among its customers.

2022Founded
New YorkHQ
$45MSeries B
ai sales intelligencegtm superintelligenceper-account agentssales automationrevenue platformreasoning models
FUNDED!
Aqfer
A
Windermere
CompanySaasAi
Aqfer

Aqfer is a white-label marketing data platform - 'The Marketing Data Engine' - that gives adtech and martech companies the heavy data infrastructure they need without building it themselves. Founded in 2018 by ad tech veterans Dan Jaye and Raymie Stata, Aqfer handles data collection, enterprise identity resolution, audience enablement, and AI data enablement at massive scale, processing trillions of rows of marketing data inside a client's own cloud. The pitch is blunt: cut back-end data costs by 40-50% and ship new data products in weeks instead of years.

2018Founded
WindermereHQ
$11,000,000Series A
adtechmartechidentity-resolutionmarketing-datadata-platformfirst-party-data
FUNDED!
BlueVoyant
B
New York
CompanyEnterpriseSaas
BlueVoyant

BlueVoyant is a New York-based cyber defense company that combines a cloud-native technology platform with a 24x7 global security operations team to protect organizations from threats inside and outside their network. Its full-spectrum platform spans managed detection and response (MDR/MXDR), digital risk protection, and supply chain (third-party) cyber risk defense, drawing on global telemetry, dark web intelligence, and a deep partnership with Microsoft and Splunk. Founded in 2017 by James Rosenthal and Thomas Glocer, the company serves enterprises and governments worldwide and has raised roughly $695M to date.

2017Founded
New YorkHQ
$140MSeries E
cybersecuritymanaged detection and responsemdrxdrthreat intelligencesupply chain defense
FUNDED!
Coast
C
New York
CompanyFintechSaas
Coast

Coast is a New York-based fintech building modern payments and expense-management software for businesses that run vehicle fleets and field teams. Its Visa-backed fuel and fleet card pairs hardware-grade spend controls with software that auto-codes receipts, matches transactions to GPS and tank data, and kills the monthly expense report. Founded in 2020 by Bread co-founder Daniel Simon, Coast has raised nearly $100M in equity plus significant debt capital, and serves thousands of fleets across construction, HVAC, landscaping, transportation and other field-heavy trades.

2020Founded
New YorkHQ
$40MSeries B
fleet cardsfuel cardsexpense managementfintechfleet managementcorporate cards
FUNDED!
Enterpret
E
New York
CompanyAiSaas
Enterpret

Enterpret is an AI customer intelligence platform that unifies scattered customer feedback - from support tickets and app reviews to sales calls and social posts - into a single, queryable source of truth. Using adaptive NLP models and a proprietary Customer Knowledge Graph, it categorizes feedback with a custom taxonomy, ties it to revenue and accounts, and surfaces the themes product teams need to decide what to build next. Founded by brothers Varun and Arnav Sharma in 2020, it counts Canva, Notion, Monday.com, Perplexity, Linear and Strava among its customers.

2020Founded
New YorkHQ
$20.8MSeries A
customer feedbackvoice of customerfeedback analyticsnlpmachine learningcustomer intelligence
FUNDED!
Kaon Interactive
KI
Maynard
CompanySaasEnterprise
Kaon Interactive

Kaon Interactive is a Maynard, Massachusetts B2B software company that builds interactive 3D product demonstrations, augmented and virtual reality experiences, and value-storytelling applications that help large enterprises explain complex products to self-directed buyers. Its patented, AI-assisted Content Experience Platform unifies marketing, sales enablement, and buyer engagement so that the same product story works on a trade-show floor, a sales call, or a buyer's late-night research session - on any device. Customers include GE Healthcare, IBM, Cisco, Dell Technologies, Thermo Fisher Scientific, Rockwell Automation, and Baker Hughes.

1996Founded
MaynardHQ
$6.4M latest round; ~$9.89M total reportedSeries B (reported)
b2binteractive 3dproduct demossales enablementaugmented realityvirtual reality
FUNDED!
LogRocket
L
Boston
CompanySaasDeveloper Tools
LogRocket

LogRocket is a Boston-based software company that combines session replay, product analytics, and error tracking into a single platform so product and engineering teams can see exactly what users experienced before something broke. Founded in 2016 by childhood friends Matthew Arbesfeld and Ben Edelstein, it now serves thousands of companies and has layered AI (Galileo) on top to surface user friction automatically.

2016Founded
BostonHQ
$25MSeries C
session replayproduct analyticserror trackingfrontend monitoringdigital experiencedeveloper tools
FUNDED!
Meadow
M
New York
CompanyFintechSaas
Meadow

Meadow is a New York-based fintech building modern financial engagement tools for higher education. Its platform helps colleges and universities communicate costs clearly, collect tuition, and support students from application through graduation - spanning a student-friendly net price calculator (Meadow Price), mobile billing and flexible payment plans (Meadow Pay), and compassionate balance recovery (Meadow Pre). Used by 300+ institutions, Meadow raised a $14M Series A led by Matrix Partners in April 2025.

2021Founded
New YorkHQ
$14MSeries A
student billingnet price calculatorhigher educationtuition paymentsfinancial aidfintech
FUNDED!
Metalenz
M
Boston
CompanyHardwareConsumer
Metalenz

Metalenz is a Boston-based deep-tech company that replaces stacks of curved glass lenses with a single flat, nanostructured semiconductor chip called a metasurface. Spun out of Harvard's Capasso Lab, it is the first company to mass-produce meta-optics, shrinking cameras and sensors for smartphones, biometrics, and 3D sensing. Its flagship Polar ID brings polarization-based, payment-grade face authentication to devices at a fraction of the size and cost of existing systems.

2016Founded
BostonHQ
$30MSeries B
meta-opticsmetasurfacemetalensnanophotonicssemiconductorbiometrics
FUNDED!
Rutter
R
New York
CompanyFintechSaas
Rutter

Rutter is a unified API that lets B2B software read and write financial data across 60+ accounting, commerce, payments, and ads platforms - from QuickBooks and NetSuite to Shopify, Amazon, and Stripe - through a single integration. Founded in 2021 by Peter Zhou and Eric Yu, the New York company is positioning itself as the 'Plaid for commerce,' powering financial workflows like lending, AP/AR automation, supplier enablement, and agentic commerce for 100+ fintech companies including Ramp, Airwallex, and Payoneer.

2021Founded
New YorkHQ
$27MSeries A
rutterunified apifintechb2baccounting apicommerce api
FUNDED!
The Arcview Group
TA
San Francisco
CompanyVcFintech
The Arcview Group

The Arcview Group is a vertically integrated cannabis and hemp company founded in 2010 by activists-turned-entrepreneurs Troy Dayton and Steve DeAngelo. Built around the Arcview Investor Network - one of the first and largest groups of accredited investors backing legal cannabis - it pairs capital and brokerage with the industry's most-cited market research, business consulting, events, and social-equity initiatives. Headquartered in San Francisco, Arcview has helped channel hundreds of millions of dollars into more than 200 cannabis companies and turned a once-illicit market into investable territory.

2010Founded
San FranciscoHQ
$7.7M (latest round)Series A
cannabiscannabis investmentventure capitalprivate equityinvestor networkmarket research
FUNDED!
Totango
T
New York
CompanySaasAi
Totango

Totango is an enterprise customer success and customer-led growth platform that helps companies monitor customer health, reduce churn, and grow recurring revenue. Founded in 2010 and headquartered in New York, it pioneered the customer success software category, connecting all of a company's customer data into a single view so post-sale teams can act on risks and expansion opportunities. In 2024 Totango merged with Catalyst under Great Hill Partners to form a combined customer growth powerhouse used by roughly 600 organizations including SAP, Google, Zoom, and GitHub.

2010Founded
New YorkHQ
~$50M combinedEarlier rounds (Seed through Series C)
customer successcustomer success platformcustomer-led growthchurn predictioncustomer health scoresaas
LEGEND!
Roy Mill
RM
PersonFounderExecutive
Roy Mill

Roy Mill is the Co-Founder and CEO of Joshu, a no-code insurance product platform that lets carriers and MGAs launch digital distribution channels in weeks rather than years. A Stanford PhD economist who pivoted into product, he spent years at Ancestry and At-Bay before founding Joshu in 2020. The company has raised $11.7M in total funding and was named to the InsurTech100 list in 2024.

insurtechinsurancesaasb2bfintechno-code
LEGEND!
Sage Wohns
SW
PersonFounderExecutive
Sage Wohns

Sage Wohns is the CEO and Co-Founder of Jericho Security, a New York-based AI cybersecurity company that trains humans and AI systems to defend against AI-powered attacks including hyper-realistic phishing, deepfakes, and voice cloning. A Seattle native and 10-year AI industry veteran, Wohns previously built and led Agolo, a Google- and Microsoft-backed NLP summarization company, before co-founding Jericho Security in 2023. The company made history by winning the Pentagon's first-ever generative AI defense contract through AFWERX in December 2023, and has since raised $18M in total funding, including a $15M Series A in April 2025. With 39 employees and 30+ enterprise clients, Jericho Security is at the frontier of AI-versus-AI cyber defense.

cybersecurityaifounderceosaasenterprise
FUNDED!
Freshworks
F
San Mateo
CompanySaasEnterprise
Freshworks

Freshworks is a cloud-based business software company that builds easy-to-use customer service, IT service management and CRM tools for companies that found legacy enterprise software too complicated and too expensive. Founded in Chennai in 2010 as Freshdesk, it became the first India-born SaaS company to list on Nasdaq in 2021 and now serves tens of thousands of customers worldwide with an AI assistant, Freddy, woven through its products.

2010Founded
San MateoHQ
$1.03BIPO (Nasdaq: FRSH)
saascustomer-service-softwareitsmcrmhelpdeskfreddy-ai
FUNDED!
Hathaway Dinwiddie
HD
San Francisco
CompanyEnterpriseClimate
Hathaway Dinwiddie

Hathaway Dinwiddie is a 100% employee-owned general contractor headquartered in San Francisco that has spent more than a century building the landmarks California works, lives, and heals in - from the Salesforce Tower to the Lucas Museum of Narrative Art and more than 10 million square feet of life-science space on the Peninsula. Built on planning, adaptation, and proactive partnership, the firm pairs century-old craft with advanced BIM workflows, LEED-driven sustainability, and an industry-leading safety record.

1911Founded
San FranciscoHQ
constructiongeneral contractoremployee-ownedesoplife sciencehealthcare construction
FUNDED!
John Paul
JP
Paris
CompanySaasEnterprise
John Paul

John Paul is a Paris-based premium concierge and customer-loyalty company that operates white-label services for luxury brands and enterprises. Founded in 2007-2008 by David Amsellem, it pairs human concierges with a proprietary CRM platform to manage the relationships brands have with their most valuable clients and employees. After merging with US rival LesConcierges in 2015, it was acquired by AccorHotels in 2016 and now runs as a business accelerator inside the Accor group, serving clients such as Visa, Hyundai, Orange and luxury houses across automotive, finance, fashion and travel.

2007Founded
ParisHQ
~US$150 million valuationAcquisition
conciergeluxurycustomer-loyaltycrmemployee-engagementpremium-customer-relationship
FUNDED!
Performance Mechanical, Inc.
PM
Pittsburg
CompanyEnterpriseClimate
Performance Mechanical, Inc.

Performance Mechanical, Inc. (PMI) is an award-winning industrial mechanical contractor founded in 1985 in Pittsburg, California. The union-craft company builds and maintains the heavy machinery behind refineries, power plants, water treatment facilities and manufacturing sites - handling process and utility piping, boiler and HRSG erection, structural steel, pipe fabrication, ASME code vessel repairs, and modern BIM and 3D laser scanning. A subsidiary of EMCOR Group since 2007, PMI serves the San Francisco Bay Area, Southern California, Sacramento, Oregon, Nevada and Hawaii with roughly 750 employees and an estimated $73M+ in annual revenue.

1985Founded
PittsburgHQ
industrial constructionmechanical contractorprocess pipingpipe fabricationboiler erectionpower plant maintenance
FUNDED!
R.S. Hughes Co., Inc.
RH
Sunnyvale
CompanyLogisticsEcommerce
R.S. Hughes Co., Inc.

R.S. Hughes Co., Inc. is a privately held, employee-owned industrial distributor founded in 1954. From its Sunnyvale, California headquarters it runs more than 40 stocking warehouses across the United States, Mexico, and Costa Rica, carrying over 350,000 products - adhesives, abrasives, tapes, safety gear, labels, electrical and shipping supplies - for aerospace, OEM, and MRO customers. Its Saunders division provides custom cutting and converting, and the company pairs deep local inventory with trained product specialists.

1954Founded
SunnyvaleHQ
industrial distributionmrosafety productsadhesivesabrasivestapes
FUNDED!
Signarama
S
West Palm Beach
CompanyEnterpriseMarketplace
Signarama

Signarama is the world's largest sign and graphics franchise, founded in 1986 by Ray and Roy Titus and now operating hundreds of independently owned stores across more than a dozen countries. Part of the United Franchise Group, Signarama turns local sign shops into full-service visual-communications businesses producing everything from banners and channel letters to vehicle wraps, trade-show displays, and ADA-compliant braille signage. Its model packages equipment, training, and a recognized brand so first-time owners can serve other local businesses that need to be seen.

1986Founded
West Palm BeachHQ
signagesignsfranchisevehicle-wrapsbannerslarge-format-printing
FUNDED!
Walters & Wolf
W&
Fremont
CompanyEnterpriseHardware
Walters & Wolf

Walters & Wolf is an employee-owned (ESOP) building-envelope contractor based in Fremont, California. Founded in 1977 by John Walters and Randy Wolf, the firm designs, engineers, fabricates, and installs curtain wall, architectural glass, metal panels, stone cladding, GFRC and architectural precast concrete, plus interior door/frame/hardware systems. With roughly 600 employees across seven locations in five western states, it is one of North America's largest building-envelope manufacturers and has clad landmark projects for Apple, Google, Adobe, Kaiser, and Sutter Health.

1977Founded
FremontHQ
curtain wallarchitectural glazingbuilding envelopefacade systemsgfrcarchitectural precast concrete
FUNDED!
Wrike
W
San Diego
CompanySaasEnterprise
Wrike

Wrike is an enterprise work management platform that helps teams plan, coordinate, and execute complex projects in one place. Founded in 2006, it combines Gantt charts, Kanban boards, custom workflows, automation, and AI agents to give large organizations visibility and accountability across thousands of users. After passing through several owners - Vista, Citrix, and now Symphony Technology Group - Wrike serves more than two million users across over 18,000 organizations.

2006Founded
San DiegoHQ
undisclosedAcquisition (Symphony Technology Group)
work managementproject managementsaasenterprise softwareteam collaborationworkflow automation
LEGEND!
Allison Romano
AR
PersonExecutiveOperator
Allison Romano

Allison Romano is Vice President of Xbox Digital Marketing and Media at Microsoft, based in New York. With over 15 years leading high-impact marketing and product teams across Microsoft, Google, American Express, and CLEAR, she has shaped how some of the world's biggest brands reach digital audiences. At Xbox, she oversees digital marketing and media strategy for one of the most recognized gaming brands on the planet, blending B2B and B2C expertise to drive growth at scale.

microsoftxboxdigital-marketinggamingvice-presidentmarketing-executive
FUNDED!
Nutshell
N
Ann Arbor
CompanySaasEnterprise
Nutshell

Nutshell is an all-in-one CRM and growth platform built for B2B small and mid-sized businesses that are tired of overpaying for software they barely use. Founded in 2009 in Ann Arbor, Michigan, Nutshell combines sales pipeline management, email marketing, and customer engagement tools into a single subscription — with free live support on every plan. Acquired by digital marketing agency WebFX in 2022, Nutshell now serves over 5,000 companies across 50 countries, competing against industry giants like Salesforce and HubSpot by doing less, but doing it better.

2009Founded
Ann ArborHQ
undisclosedSeed (follow-on)
crmsalesmarketingsmall-businessb2bemail-marketing
FUNDED!
Oracle Sales Cloud
OS
Austin
CompanySaasEnterprise
Oracle Sales Cloud

Oracle Sales Cloud (CX Sales) is Oracle's enterprise-grade cloud CRM platform that combines sales automation, AI-driven forecasting, configure-price-quote (CPQ), and subscription management into a single suite. Built on Oracle Fusion Cloud, it connects directly with Oracle ERP and supply chain data, letting sales teams quote accurately, close faster, and forecast confidently - without the integration tax that plagues competing platforms. With 5,500+ enterprise customers and $57.4 billion in annual parent revenue, Oracle Sales Cloud targets large organizations that demand reliability, data depth, and AI at scale.

1977Founded
AustinHQ
crmsales-automationenterprise-softwarecloud-computingaicpq