Pricing
TAGS

Tagged Content

Tagged: ai-agents

Everything on the platform tagged with ai-agents.

Browse all tags
b2b saas14saas13b2b10digital health10fintech9d2c9telehealth7machine learning7ai7climate tech7biotechnology6wellness6proptech6biotech5circular economy5oncology5enterprise ai5supply chain4remote patient monitoring4agentic ai4food and beverage4ecommerce4healthtech4real estate technology4reinforcement learning4sustainability4developer tools4decarbonization4medical devices4clinical-stage3immunotherapy3ai logistics3hr tech3developer-tools3value-based care3ai agents3new york startup3chronic disease management3y combinator3san francisco startup3computer vision3robotics3biopharmaceutical2zero trust2waste diversion2sustainable advertising2monoclonal-antibodies2alzheimers2neurodegeneration2real-world-assets2rwa2defi2blockchain2crypto2precision medicine2drug development2personalized medicine2claims management2enterprise software2usage-based pricing2virtual care2femtech2endometriosis2cell therapy2holistic health2gut health2mobile app2dtc2direct-to-consumer2shopify2social determinants of health2care navigation2population health2lead generation2financial inclusion2energy efficiency2deepmind alumni2longevity2clinical trials23d printing2b2b software2london startup2earned wage access2api integration2workflow automation2workday2carbon accounting2functional mushrooms2adaptogens2plant-based2lions mane2cordyceps2reishi2immune support2proteomics2data analytics2marketing automation2heart failure2multiple sclerosis2healthcare technology2continuous monitoring2leak detection2regulatory compliance2iot sensors2manufacturing2generative ai2ai infrastructure2clinical-stage biotech2deep tech2eda2semiconductors2clean energy2healthcare analytics2employee benefits2inventory management2wearable robotics2exoskeleton2assistive technology2deep learning2fashion tech2palo alto startup2edtech2carbon reduction2defense tech2ai for finance2vegan2new york2e-commerce2subscription2insurtech2ophthalmology1eye-disease1bispecific-antibody1wet-amd1diabetic-macular-edema1vision1austin-biotech1series-a1drug-development1passwordless authentication1identity and access management1biometric authentication1facial recognition1frontline workers1deskless workers1physical access control1multi-factor authentication1fido21passkeys1shared device access1ai identity agent1time clock1no-code workflow1workforce identity1phishing-resistant mfa1nfc access1rfid badges1reverse vending machine1beverage container recycling1ai recycling1retail media network1plastic recycling1consumer recycling1recycling rewards1digital out-of-home advertising1rpet1recycling data analytics1container deposit refund1olyns cube1cancer-immunotherapy1ctla-41gotistobart1onc-3921siglec-101cd241checkpoint-inhibitor1tumor-microenvironment1treg-modulation1clinical-trials1rockville-maryland1biontech-partner1immune-checkpoint1tokenization1tokenized-treasuries1stablecoin1ousg1usdy1ondo-chain1institutional-defi1on-chain-securities1asset-management1tokenized-stocks1yield1canine cancer1veterinary oncology1comparative oncology1ai in veterinary medicine1genomic testing1targeted therapy1dog cancer1real-world evidence1biomarker discovery1animal health1clinico-genomics1auto protection1community insurance1insurance alternative1mutual aid1collision coverage1comprehensive coverage1shared risk1depin1olt token1safe driving rewards1vehicle protection1ai damage assessment1auto insurance alternative1last mile delivery1delivery orchestration1logistics technology1omnichannel fulfillment1courier network1same-day delivery1route optimization1multi-carrier management1real-time visibility1logistics as a service1final mile1dynamic fulfillment1carrier network1delivery automation1orlando startup1upskilling1reskilling1learning and development1corporate training platform1skills management software1ai in hr1talent development1employee development platform1learning marketplace1skills gap analysis1hris integration1workforce upskilling1skills-first1professional development1microlearning1learning analytics1internal mobility1bitcoin1lightning-network1bitcoin-payments1payment-processor1crypto-payments1payouts1payment-gateway1bitcoin-api1hosted-checkout1in-person-payments1currency-conversion1settlement1ecommerce-plugins1merchant-payments1instant-settlement1pelvic health1pelvic floor physical therapy1womens health1physical therapy1postpartum care1menopause1insurance covered pt1painful sex1pelvic organ prolapse1bladder control1diastasis recti1trauma-informed care1evidence-based care1healthcare1cell-therapy1parkinsons-disease1neuron-replacement1ipsc1dopaminergic-neurons1neurodegenerative1autologous1regenerative-medicine1neuroscience1stem-cells1virtual gi care1digestive health1gastroenterology1ibs1ibd1crohns disease1ulcerative colitis1gerd1multidisciplinary care1gut-brain1behavioral health integration1registered dietitian1virtual specialty care1center of excellence1health plan partnerships1whole-person care1osmo1digital olfaction1ai scent1olfactory intelligence1scent teleportation1fragrance ai1principal odor map1smell digitization1molecular discovery1graph neural networks1aroma molecules1alex wiltschko1google brain spinout1generation by osmo1scent design1ostium1perpetuals1perps1decentralized-exchange1dex1arbitrum1onchain-trading1commodities1forex1stocks1indices1synthetic-assets1leverage1self-custody1tradfi1protein design1ai protein design1immuno-oncology1car t cells1solid tumors1synthetic biology1de novo proteins1cytokines1cancer treatment1seattle biotech1programmable proteins1music production software1virtual instruments1audio plugins1sound design1ai music1arcade1co-producer1sample library1vst plugins1music technology1daw1royalty-free samples1music creation1los angeles startup1summit partners1ai cybersecurity1brand protection1digital threat detection1impersonation removal1phishing detection1deepfake detection1threat intelligence1automated threat response1scam takedown1executive protection1soar integration1siem integration1open-source intelligence1digital trust1boozy tea1hard tea1canned cocktails1spiked pop1hard soda1tea cocktails1real ingredients1low sugar alcohol1low calorie1women-led1tea sommelier1botanicals1ready-to-drink1craft beverage1responsible drinking1legal software1legal tech1ediscovery1social media evidence1web capture1digital evidence1chain of custody1court admissibility1website archiving1metadata and hashing1affidavit generation1litigation support1evidence preservation1remote browsing1legal services1pizza1restaurants1new england1thin-crust pizza1quick service1massachusetts1pizzeria1italian food1dedham1regional chain1family restaurant1postgres1search1full-text-search1bm251analytics1olap1elasticsearch-alternative1open-source1database1tantivy1rust1pg_search1acid1opensearch1functional medicine1telemedicine1root-cause medicine1autoimmune care1hormonal health1metabolic health1preventive medicine1lab testing1biomarker testing1health coaching1nutrition1membership healthcare1women's health1lifestyle medicine1primary care1event planning1online invitations1rsvp tracking1party planning1guest management1evite alternative1gen z1consumer social1ticketing1birthday invites1text message invites1event management1social events1andreessen horowitz1healthcare financing1patient financing1point-of-sale financing1medical aesthetics1elective procedures1buy now pay later1bnpl healthcare1plastic surgery financing1dental financing1fertility financing1lasik financing1soft credit check1practice management1monthly payment plans1patient affordability1pattern-brands1home-goods1consumer-brands1brand-aggregator1brand-acquisition1kitchen-tools1home-organization1home-decor1gin-lane1new-york1multi-brand-platform1consumer-products1brand-building1community health workers1chw1sdoh1care management1medicaid billing1health plans1promotores1doulas1case management1ai workflows1community-based organizations1referral management1b2b data1data enrichment1people data1company data1data as a service1daas1developer apis1person enrichment1company enrichment1data provider1sales intelligence1identity resolution1data science1professional profiles1ip enrichment1job posting data1big data1api1relocation1global mobility1ai home search1employee relocation1immigration1visa support1destination services1relocation management1expense management1mobility platform1corporate relocation1international relocation1mls platform1residential real estate1data and workflow platform1market analytics1agent productivity1listing management1client collaboration1reso certified api1real estate data1new york city real estate1ai property descriptions1diabetes management1type 2 diabetes1connected glucose meter1blood glucose monitoring1medicare1doctor-led care1senior health1at-home diabetes care1personalized coaching1asset-backed credit card1secured credit card1pawn alternative1credit building1underbanked1mastercard1consumer lending1collateral lending1industrial ai1data center cooling1ai control systems1autonomous control1virtual plant operator1ai factories1mission critical facilities1closed-loop control1pue reduction1self-learning ai1liquid cooling1chiller plant optimization1body composition1mri1medical imaging1radiomics1phenotyping1quantified self1whole-body imaging1digital physical exam1accessible imaging1physna1thangs13d search1geometric search1geometric deep learning13d model search engine1object dna1cad1intellectual property protection1manufacturing software1enterprise saas1columbus ohio1adtech1digital advertising1social display1user-first advertising1mobile advertising1carbon neutral ads1publisher monetization1programmatic1ad formats1attention metrics1open web1creative optimization1inventory quality1pinwheel1payroll api1income verification1direct deposit switch1deposit switching1account activation1switch kit1primacy1bill switching1payroll data connectivity1real-time income data1fcra compliance1consumer reporting agency1banking technology1open banking1credit unions1neobanks1pipedream1serverless1mcp servers1model context protocol1no-code automation1low-code1integration platform1ipaas1connect sdk1lifecycle assessment1ghg inventory1scope 3 emissions1net zero1climate software1consumer products1cpg1carbon labels1science based targets1supplements1mushroom gummies1vegan supplements1nootropics1b corporation1climate neutral1herbal supplements1clean label1brain health1sleep support1austin1texas1gummy vitamins1agentic-ai1code-simulation1software-quality1predictive-software-quality1ai-debugging1enterprise-software1codesim1sim-11engineering-productivity1bug-prevention1ai-generated-code1root-cause-analysis1b2b-saas1atlanta-startup1stanford-dawn1telemetry1support-engineering1knowledge-graph1genomics1multi-omics1molecular-diagnostics1hypercoding1raptor-platform1clinical-genomics1biomarker-detection1signal-processing1laboratory-automation1life-sciences1san-diego-biotech1target-detection1policymap1geospatial data1data visualization1location intelligence1gis1mapping platform1demographics1site selection1housing data1community development1philadelphia1public data1neighborhood data1interactive maps1spatial analysis1data licensing1product analytics1open source1feature flags1session replay1a/b testing1experimentation1surveys1data warehouse1web analytics1error tracking1customer data platform1product os1self-hosted analytics1remote-first1open-core1ai product assistant1sql1bioprinting13d-bioprinting1lymph-node-organoid1antibody-discovery1human-antibodies1immune-system1drug-discovery1two-photon-bioprinting1ai-drug-discovery1immunology1organoids1therapeutics1exis-platform1audience-data1advertising1demand-generation1account-based-marketing1abm1martech1identity-resolution1data-enrichment1audience-targeting1match-rate-optimization1incrementality-testing1website-de-anonymization1salesforce-sync1meta-audiences1linkedin-targeting16sense1demandbase1growth-marketing1san-francisco1craft-ventures1salesforce-ventures1conversion-tracking1privacy-compliant1email marketing1sms marketing1popups1list growth1cart abandonment1conversion optimization1small business1exit intent1spin to win1segmentation1customer retention1bigcommerce1wix1drag and drop email editor1abandoned cart recovery1circulatory support1aortix1percutaneous pump1cardiorenal syndrome1mechanical circulatory support1cardiology1houston medtech1fda breakthrough device1renal perfusion1blood pump1cardiovascular devices1drain-hf1lupus1autoimmune disease1flare prediction1blood biomarkers1diagnostics1clinical laboratory1patient engagement1lupuscorner1aisle dx1digital biomarkers1systemic lupus erythematosus1oklahoma city1biomarker validation1digital therapeutics1methane monitoring1emissions data1esg1oil and gas1ldar1ghg reporting1responsibly sourced gas1trustwell1canary x1air quality1energy1saas platform1denver1ai-native gtm1go-to-market automation1multiagent operations1workflow orchestration1coordination infrastructure1sales automation1metaverse1web31nft oasis1virtual events1silicon valley1digital cmc1pharmaceutical software1biotech software1quality by design1qbd1product lifecycle management1plm121 cfr part 111iso 134851gamp51knowledge management1tech transfer1life sciences1austin texas1ai-ready1healthcare ai1clinical decision support1health systems1ai governance1llms1health it1hospitals1epic integration1public benefit company1medical software1health informatics1kras inhibitors1ras-driven cancers1allosteric drug discovery1second harmonic generation1shg technology1targeted cancer therapy1g12d inhibitor1g12v inhibitor1pan-kras1small molecule drugs1precision oncology1pancreatic cancer1colorectal cancer1drug discovery platform1protein conformation1phase 1 clinical trials1south san francisco biotech1bayesian optimization1chemicals1materials science1formulation1r&d1experimental design1design of experiments1specialty chemicals1paints and coatings1pharmaceuticals1materials informatics1maritime1maritime-intelligence1maritime-domain-awareness1defense1defense-technology1ocean-surveillance1vessel-tracking1smartmast1distributed-sensor-network1edge-ai1computer-vision1ais1radar1infrared-imaging1satellite-communication1autonomous-vessel-monitoring1national-security1hive-mind1real-time-surveillance1pcb design1automated pcb layout1physics-driven ai1electronics design automation1autonomous routing1circuit board design1hardware1aerospace and defense1physics simulation1design validation1flow battery1long-duration energy storage1organic quinones1redox flow battery1grid energy storage1renewable energy1energy storage1harvard spinout1battery manufacturing1aqueous organic flow battery1vanadium alternative1domestic supply chain1ldes1implantable sensor1blood pressure1hypertension1biosensor1wireless implant1qsmart1qsense1preclinical medtech1intraocular pressure1glaucoma1post-quantum cryptography1pqc1quantum-safe encryption1cybersecurity1crypto-agility1cryptographic agility1quantum security1network security1data in transit1harvest now decrypt later1nist standards1critical infrastructure1government security1satellite security1quprotect1crypto inventory1cryptographic bill of materials1enterprise security1quantum readiness1ewa1on-demand pay1financial wellness1payroll1financial health1instant pay1daily pay1financial literacy1employee retention1hourly workers1santa monica1ramani1ramani.io1tanzania1africa1b2b fintech1micro-distribution1cpg supply chain1supply chain finance1working capital1point of sale1pos software1merchant management1dar es salaam1supply chain digitization1b2b ecommerce1embedded finance1fmcg1emerging markets1offline software1low-connectivity1medical robotics1motorized knee orthosis1ai gait biomarker1neurological rehabilitation1stroke recovery1mobility assistance1electro-hydraulic actuation1gait analysis1dreeven1reev sense1rehabilitation technology1paraplegia mobility1patient monitoring1techstars1artificial intelligence1superintelligence1open models1open source ai1autonomous coding1coding agents1large language models1frontier ai1asimov1mixture of experts1ai research1ai safety1post-training1modular construction1microfactory1physical ai1net-zero homes1prefab homes1affordable housing1offsite manufacturing1climate-resilient housing1fire-resistant homes1construction automation1passive house1amazon robotics1somerville massachusetts1housing crisis1aerospace1rockets1additive manufacturing1reusable rockets1terran r1terran 11aeon engines1stargate 3d printer1space launch1launch services1satellite deployment1low earth orbit1geosynchronous transfer orbit1propulsion1methane rocket1autonomous manufacturing1robotic manufacturing1space economy1nasa stennis1cape canaveral1eric schmidt1tim ellis1data centers in orbit1ai visual inspection1machine vision1quality assurance automation1industry 4.01defect detection1smart manufacturing1no-code ai1shop-floor ai1predictive maintenance1non-destructive testing1relivision1edge and cloud1process control1carbon capture1mobile carbon capture1tailpipe capture1heavy-duty trucks1locomotives1freight rail1co2 removal1carbon removal1climatetech1greentech1adsorbents1zero-backpressure1tier 4 emissions1carbon credits1co2 offtake1detroit1michigan1hardware manufacturing1transportation1yard management1yard execution system1logistics software1dock scheduling1gate automation1driver check-in1freight movement1waire program1isr compliance1scaqmd rule 23051emissions reporting1freight theft prevention1biometric driver validation1contactless operations1detention and demurrage1warehouse management1transportation management1control tower visibility1ebol1epod1milwaukee startup1cloud-based platform1rental platform1ai rental assistant1tenant screening1property management1long-term rentals1digital lease1rent payment automation1modular homes1global rental marketplace1blockchain rental1rental application1ukrainian founders1virtual tours1automated rent collection1rental pricing1pre-ipo1equipment rental software1rental management1heavy equipment1construction tech1ai-powered1online storefront1quickbooks sync1mobile inspections1fleet management1rental operating system1payments and invoicing1chicago startup1plastic neutral1plastic credits1epr compliance1packaging compliance1extended producer responsibility1plastic recovery1ocean-bound plastic1sustainability software1impact verification1plastic footprint1waste worker empowerment1cpg sustainability1plastic offset1advanced recycling1chemical recycling1microwave pyrolysis1cmap technology1plastic to oil1pyoil1plastic waste1modular recycling1decentralized recycling1pyrolysis1low carbon fuel1cleantech1circular plastics1petrochemical1aging1rejuvenation1autophagy1cellular reprogramming1gene therapy1microglia1plasma therapeutics1healthspan1stem cells1regenerative medicine1sam altman1rtr2421silicon valley biotech1single-cell multi-omics1property management software1trust accounting1embedded banking1embedded payments1ap ar automation1maintenance tracking1portfolio management1detroit startup1multifamily1single-family rentals1student housing1gaap accounting1owner distributions1bank reconciliation1resident portals1ruby on rails1ai property management1returns recovery1deadstock1circular fashion1sustainable fashion1inventory recovery1b-corp1reverse logistics1refurbishment1resale1ai inventory1garment recovery1retail technology1supply chain sustainability1asset recovery1ai chip design1semiconductor1alphachip1frontier ai lab1custom silicon1tpu1chip design automation1designless1ai hardware co-design1online education1online program management1opm1higher education1university partnerships1regional universities1workforce-focused degrees1adult learners1student support1enrollment management1marketing services1online nursing programs1student roi1academic partnerships1wiley university services1waste management1recycling1zero waste1waste metering1esg reporting1landfill diversion1commercial recycling1facility services1pittsburgh startup1cardboard recycling1waste analytics1smart waste1knee brace1osteoarthritis1mobility1pneumatic actuators1military exoskeleton1human augmentation1rehabilitation1dual-use technology1pain reduction1education technology1stem education1coding for kids1robotics kit1gamified learning1c++ programming1e-learning1consumer electronics1silicon valley startup1ai education1origin kit1castle rock platform1rogo1rogo ai1financial ai1investment banking ai1felix1private equity1hedge funds1financial modeling1due diligence1deal sourcing1secure ai1wall street1llms for finance1financial research automation1mezcal1agave-spirits1oaxaca1single-estate1organic-spirits1sustainable-spirits1beverage-manufacturing1tequila-alternative1craft-spirits1carbon-neutral1distintivo-verde1santiago-matatlan1espadin1premium-spirits1ear piercing1nurse-led piercing1hypoallergenic jewelry1medical-grade jewelry1safe piercing1pediatric ear piercing1ear stacking1retail studios1jewelry1consumer brand1licensed nurses1needle piercing1ear care1rowspace1financial intelligence1institutional knowledge1private equity ai1portfolio monitoring1credit analysis1proprietary data1decision intelligence1sequoia1emergence capital1michael manapat1yibo ling1music royalties1royalty processing1music publishing administration1mechanical licensing1royalty accounting1music rights management1catalog registration1white-label royalties1music industry1royalty audit1music licensing1music business management1music finance1military logistics1predictive logistics1edge ai1contested logistics1tyros1offline-first1mesh networking1sustainment1govtech1anduril alumni1series a1arlington virginia1smart building1building automation1heating controls1boiler management1wireless sensors1hvac1local law 971local law 841local law 871energy management1demand response1new york city1mushroom coffee1superfoods1medicinal mushrooms1coffee alternative1organic1gluten-free1no jitters1boston startup1consumer health1earthquake risk management1catastrophe risk1structural health monitoring1building sensors1parametric insurance1seismic risk analytics1disaster response1real-time damage assessment1reinsurance1business continuity1san francisco1cruisebound1cruise booking1online travel agency1travel tech1startup founder1ceo1mit1polytechnique montreal1series b1thayer ventures1booking holdings1travel startup1leisure1tourism1mobile-first1canada1industrial engineering1antibody engineering1antibody-drug conjugates1bispecific antibodies1cardiovascular1nrg-11erbb415t41biparatopic adc1protein therapeutics1drug discovery1gaithersburg maryland1biologics1first-in-class1prior authorization1specialty medications1medical benefit1biologics access1patient access1ai healthcare1emr integration1pharma market access1benefit verification1rheumatology1retina1neurology1neurotechnology1womens-health1pmdd1menstrual-pain1wearable1tdcs1brain-stimulation1neurostimulation1drug-free1hormone-free1non-invasive1nettle1medical-device1neuroplasticity1menstrual-health1pms1digital-health1health insurtech1small business health insurance1employer sponsored health insurance1group medical plans1level-funded plans1virtual primary care1benefits administration1healthcare cost reduction1austin startup1sana care1headless cms1content operating system1structured content1content lake1groq1portable text1sanity studio1api-first1composable content1ai content1omnichannel1real-time collaboration1content infrastructure1digital experience platform1content management1visual editing1enterprise content1lingerie1intimates1loungewear1size inclusivity1body positivity1inclusive fashion1rihanna1fenty1bras1underwear1mens essentials1bridal lingerie1xtra vip1personalization1ai sizing1fit match1diverse models1apparel1fashion show1amazon prime video1facebook ads1instagram ads1google ads1tiktok ads1meta ads1ad automation1ad optimization1lookalike audiences1retargeting1audience targeting1shopify app1ecommerce ads1dropshipping1roas optimization1ai ad copy1ad creative generation1campaign analytics1ad scaling1media buying1digital marketing software1silicon photonics1integrated photonics1integrated lasers1optical interconnects1dwdm1co-packaged optics1ai data centers1photonic integrated circuits1iii-v on silicon1ship technology1leaf light1optical transceivers1fabless1grenoble1predictive analytics1decision sciences1data engineering1scorefast1customer engagement1fraud detection1contact center ai1financial services1insurance1model management1etl services1ai/ml platform1risk assessment1churn management1call routing1
Often tagged with
Showing 30 results for ai-agents
Sort:
FUNDED!
Castellum.AI
C
New York
CompanyAiFintech
Castellum.AI

Castellum.AI is a New York-based regulatory technology company that automates anti-money-laundering and know-your-customer compliance for banks, credit unions, fintechs and crypto firms. Its platform pairs in-house risk data drawn from 200,000+ global sources with explainable AI agents that screen for sanctions, politically exposed persons and adverse media, cutting alert volume by 94% and review time by 83% out of the box. Founded by a former U.S. Treasury sanctions officer, the company raised an $8.5M Series A in July 2025 led by Curql.

2019Founded
New YorkHQ
$8.5MSeries A
amlkyccomplianceregtechfinancial-crimesanctions-screening
FUNDED!
Airtable
A
San Francisco
CompanySaasAi
Airtable

Airtable is a San Francisco software company that turned the humble spreadsheet into a flexible app platform, letting non-engineers build relational databases, interfaces, and automated workflows without code. Founded in 2012 and launched publicly in 2015, it now serves more than 500,000 organizations - including the majority of the Fortune 100 - and has refounded itself as an AI-native app platform anchored by its conversational builder, Omni.

2012Founded
San FranciscoHQ
$735MSeries F
airtableno-codelow-codeapp-platformrelational-databasespreadsheet-database
FUNDED!
Freshworks
F
San Mateo
CompanySaasEnterprise
Freshworks

Freshworks is a cloud-based business software company that builds easy-to-use customer service, IT service management and CRM tools for companies that found legacy enterprise software too complicated and too expensive. Founded in Chennai in 2010 as Freshdesk, it became the first India-born SaaS company to list on Nasdaq in 2021 and now serves tens of thousands of customers worldwide with an AI assistant, Freddy, woven through its products.

2010Founded
San MateoHQ
$1.03BIPO (Nasdaq: FRSH)
saascustomer-service-softwareitsmcrmhelpdeskfreddy-ai
FUNDED!
Twilio
T
San Francisco
CompanySaasDeveloper Tools
Twilio

Twilio is a cloud communications platform that turns telephone networks, SMS, email, and messaging apps into a few lines of code. Through programmable APIs for voice, messaging, email, and identity verification, plus a customer data platform built on its Segment acquisition, Twilio lets developers and enterprises embed communication and customer engagement directly into their software. More than 400,000 active customer accounts, including roughly 90% of the Fortune 500, build on it.

2008Founded
San FranciscoHQ
~$150M raised at $15/shareIPO (NYSE: TWLO)
cpaascommunications-apismsvoicemessagingemail-api
FUNDED!
Zapier
Z
San Francisco
CompanySaasAi
Zapier

Zapier is the automation platform that connects more than 8,000 apps so people can build workflows - called Zaps - without writing code. Founded in 2011 by Wade Foster, Bryan Helmig and Mike Knoop, the fully remote company has grown from a Y Combinator side project into a roughly $5 billion business serving millions of users, and it is now reorienting around AI agents that don't just move data between apps but make decisions inside the workflow.

2011Founded
San FranciscoHQ
undisclosed (valued company at $5B)Secondary
automationno-codeworkflow-automationai-agentsintegrationsapi
LEGEND!
Alex Reibman
AR
PersonFounderEngineer
Alex Reibman

Alex Reibman is the Co-Founder and CEO of AgentOps (Agency), a San Francisco-based developer platform for building, testing, and monitoring AI agents. A 17-time hackathon champion with 10+ years of machine learning experience, he previously led ML engineering at Ernst & Young on $40M+ engagements for clients like Goldman Sachs and American Express, co-founded Menubites.ai (acquired by Snappr in 2023), and worked as a cybersecurity data scientist. AgentOps raised a $2.6M pre-seed in August 2024 and serves enterprise clients including Microsoft, Google, Samsung, and Meta. He studied Economics and Philosophy at Emory University and won the 2024 Emory Entrepreneur Award.

ai-agentsagentopsllm-observabilitymachine-learningdeveloper-toolssan-francisco
READ IT!
The Ask-and-Act Web: How AI Is Rewiring the Internet 2026–2029
TA
StoryAiMedia
The Ask-and-Act Web: How AI Is Rewiring the Internet 2026–2029

A data-driven editorial report mapping how the AI-native internet will reshape search, content, attention and brand visibility between 2026 and 2029. The piece argues the web is shifting from 'search and click' to 'ask and act' — answer engines synthesize replies, agents transact on users' behalf, and the open link economy is being renegotiated in real time. Drawing on 30+ primary sources including Pew Research, McKinsey, Cloudflare, Stanford HAI, and Similarweb, it covers the adoption explosion (900M weekly ChatGPT users), the great decoupling of searches from clicks (69% zero-click), the stumbling first steps of agentic commerce, the rise of synthetic content (52% of new articles AI-generated), and a practical playbook for publishers, brands, and e-commerce operators navigating the shift.

aisearchseogeoaeoanswer-engines
FUNDED!
Nanonets
N
San Francisco
CompanyAiSaas
Nanonets

Nanonets is a San Francisco-based AI company that turns messy, unstructured documents - invoices, receipts, contracts, claims - into clean, structured data that flows directly into systems like SAP and Salesforce. Founded in 2017 by Sarthak Jain and Prathamesh Juvatkar, the company builds OCR and deep-learning agents that automate the dull back-office work nobody wants to do.

2017Founded
San FranciscoHQ
$29MSeries B
aiocrdocument-processingidpautomationmachine-learning
FUNDED!
Assembled
A
San Francisco
CompanySaasAi
Assembled

Assembled is a San Francisco-based software company building the workforce management and AI agent platform for modern customer support teams. Founded in 2018 by three Stripe veterans, it now helps companies like Stripe, Robinhood, GoFundMe, Etsy, and Intercom forecast demand, schedule agents, and resolve a growing share of tickets with AI across chat, voice, and email.

2018Founded
San FranciscoHQ
$51MSeries B
workforce-managementcustomer-supportai-agentscontact-centerwfmsupport-operations
FUNDED!
Augment
A
San Francisco
CompanyAiLogistics
Augment

Augment builds Augie, an AI teammate purpose-built for logistics. The San Francisco company automates the phone calls, emails, portal logins, and back-office workflows that bog down freight brokers, shippers, and carriers - and has raised $110M in under a year to scale it.

2024Founded
San FranciscoHQ
$85MSeries A
ailogisticsfreightsupply-chaintruckingfreight-brokerage
FUNDED!
Automation Anywhere
AA
San Jose
CompanyAiEnterprise
Automation Anywhere

Automation Anywhere is a San Jose-based enterprise software company building agentic process automation - software bots and AI agents that handle the repetitive office work humans do not want to do. Its Automation 360 platform combines RPA, document AI, and generative-AI co-pilots to run end-to-end workflows for global enterprises across finance, healthcare, manufacturing, and the public sector.

2003Founded
San JoseHQ
$250MSeries A (recap)
rpaagentic-aiintelligent-automationhyperautomationprocess-automationai-agents
FUNDED!
Gruve
G
Redwood City
CompanyAiEnterprise
Gruve

Gruve is an outcome-based enterprise AI services company that helps large organizations move from AI strategy to production-grade deployment across customer experience, cybersecurity, data and platform engineering — billing on results rather than billable hours.

2024Founded
Redwood CityHQ
$20MSeries A
aienterprise-aiai-agentscybersecurityai-socdata-engineering
FUNDED!
Lumber
L
San Jose
CompanyAiFintech
Lumber

Lumber is an AI-powered construction workforce management platform that unifies payroll, time tracking, HR, safety, compliance, and field productivity for contractors. Founded in 2023 by Shreesha Ramdas and Manish Kumar, the company is building autonomous AI agents for an industry where 41% of the workforce is set to retire in seven years.

2023Founded
San JoseHQ
$5.5M (approx.)Seed
constructionpayrollworkforce-managementai-agentscertified-payrollprevailing-wages
FUNDED!
Pallet
P
San Francisco
CompanyAiSaas
Pallet

Pallet is a San Francisco AI startup building an 'AI workforce' for the logistics industry. Its flagship product, CoPallet, automates back-office freight workflows - order entry, quoting, document parsing, portal updates - that have historically required armies of human operators. Founded in 2020 by ex-Retool engineer Sushanth Raman, the company serves freight brokers, 3PLs, warehouses and carriers including STG Logistics, Mallory Alexander, Knight, Swift and Lineage.

2020Founded
San FranciscoHQ
$27MSeries B
logisticsaisaasfreightsupply-chainautomation
FUNDED!
Merge
M
San Francisco
CompanySaasDeveloper Tools
Merge

Merge builds the connective infrastructure for modern SaaS and AI: one unified API that lets a product offer hundreds of HRIS, ATS, CRM, ticketing, and accounting integrations - and a newer Agent Handler that gives AI agents secure, observable access to thousands of third-party tools.

2020Founded
San FranciscoHQ
$55MSeries B
unified-apiintegrationshrisatscrmaccounting
FUNDED!
Netlify
N
San Francisco
CompanyDeveloper ToolsSaas
Netlify

Netlify is the platform that taught the modern web to ship fast. Founded in 2014 by Mathias Biilmann and Christian Bach, it pioneered the Jamstack architecture and a Git-driven workflow that turned every push into a production deploy. Today, more than five million developers and companies like Twilio, Unilever, and Peloton run on Netlify's global edge network - and the company is reinventing itself again around AI agents that ship code on behalf of humans.

2014Founded
San FranciscoHQ
$105MSeries D
jamstackweb-hostingcdnedge-functionsci-cdserverless
LEGEND!
Abhinav Asthana
AA
PersonFounderExecutive
Abhinav Asthana

Abhinav Asthana is the co-founder and CEO of Postman, the world's leading API platform used by over 35 million developers and 500,000 organizations. Growing up in small-town Uttar Pradesh, India, he taught himself programming as a child, built virtual tour software before finishing college, and turned a side project Chrome extension into a company valued at $5.6 billion. He moved Postman from Bangalore to San Francisco in 2017 and has raised $433 million in total funding, including a $225M Series D in 2021.

postmanapideveloper-toolssaasenterprise-softwarestartup-founder
LEGEND!
Alessio Alionco
AA
PersonFounderExecutive
Alessio Alionco

Alessio Alionco is the Brazilian-born founder and CEO of Pipefy, a San Francisco-based AI-driven process automation platform he built from scratch in 2015. A Lean Six Sigma Black Belt, Harvard OPM alumnus, and Endeavor Entrepreneur, he turned a front-row view of chaotic enterprise workflows into a company with 4,700+ deployed AI agents, partnerships with Accenture, and over $225M in total funding. His prior venture, Acessozero, grew to 1 million users before being acquired by Brazilian local-search giant Apontador in 2012 - a deal that planted the seeds for Pipefy.

founderceopipefyprocess-automationworkflowai-agents
LEGEND!
Bret Taylor
BT
PersonFounderExecutive
Bret Taylor

Bret Taylor is the co-founder and CEO of Sierra, an enterprise AI agent platform valued at $15.8 billion following its $950M Series E in May 2026. A Stanford computer science graduate, he co-created Google Maps, helped invent Facebook's Like button, served as Facebook CTO, co-founded Quip (acquired by Salesforce), and rose to co-CEO of Salesforce before founding Sierra in 2023. He also chairs the OpenAI board, having stabilized the company after Sam Altman's brief ouster in November 2023. Forbes recognized him as a billionaire in 2025, and Silicon Valley has nicknamed him the 'Forrest Gump of Silicon Valley' for his uncanny presence at every landmark moment in the internet age.

aisierraopenaigoogle-mapsfacebooksalesforce
LEGEND!
Chase Kim
CK
PersonFounderOperator
Chase Kim

Chase Kim is a startup founder who spent years deep inside Sendbird, the messaging infrastructure company powering conversations for DoorDash, Reddit, and Hinge, where he led the forward deployment team during Sendbird's critical 2024 pivot into AI agents for customer experience. In 2026, he co-founded Light Anchor (YC P26) with Sangha Park to build fully autonomous e-commerce brands run entirely by AI agents, betting that the future of consumer business is capped by compute, not headcount.

sendbirdlight-anchorycy-combinatorai-agentssaas
LEGEND!
Dheeraj Pandey
DP
PersonFounderExecutive
Dheeraj Pandey

Dheeraj Pandey is the co-founder and CEO of DevRev, an AI-native CRM and support platform valued at $1.15 billion. A serial unicorn builder, he previously co-founded Nutanix in 2009 and led it as CEO through its 2016 Nasdaq IPO, scaling it to an $18+ billion enterprise. Born in Patna, Bihar, India, he arrived in the US in 1997 with $900 borrowed from education trusts, earned his MS at UT Austin, and spent over two decades building distributed systems before founding two generational companies. He sits on Adobe's board and has donated over $20 million to humanitarian causes, including a $10 million gift to UT Austin for personalized medicine research.

devrevnutanixaisaasenterprise-softwareceo
LEGEND!
Michael Gilson
MG
PersonExecutiveOperator
Michael Gilson

Michael Gilson is the CEO of Conversica, the San Francisco-based conversational AI company behind over 1.5 billion automated customer conversations. Appointed in April 2025, he has repositioned Conversica as 'The Conversation Company,' expanding its AI agent platform from sales automation into automotive data intelligence, sports and entertainment ticketing, and enterprise customer lifecycle management. A Princeton graduate with a background spanning enterprise SaaS, media technology at Telestream, and data analytics at Wiser Solutions, Gilson brings operator instincts to a company that pioneered AI-to-human conversation at scale.

ceoconversicaconversational-aisaasenterprise-softwareai-agents
LEGEND!
Mukunda S
MS
PersonFounderEngineer
Mukunda S

Mukunda Srinivasagowda is a seasoned technologist and Co-Founder of SuperAGI, a Palo Alto-based AI company building a full-stack agentic intelligence platform. With over 13 years spanning Amazon, Zomato, and fintech unicorn Navi, he co-built SuperAGI from the ground up in 2023 alongside CEO Ishaan Bhola. The company's open-source autonomous agent framework earned 17,500+ GitHub stars, attracted a $10 million Series A led by Jan Koum's secretive Newlands VC, and spawned a suite of AI-native products including SuperSales, SuperMarketing, and SuperCoder - all targeting the shift from LLMs that generate content to agents that actually take action.

superagiai-agentsopen-sourceautonomous-aico-founderagentic-ai
LEGEND!
Nina Kuruvilla
NK
PersonFounderOperator
Nina Kuruvilla

Nina Kuruvilla is co-founder of Daily.co, a San Francisco-based enterprise WebRTC platform that powers real-time voice and video for thousands of developers and enterprises. After co-founding Daily in 2016 through Y Combinator, she guided the company through 30x revenue growth during the pandemic and championed the open-sourcing of Pipecat - a vendor-neutral Python framework for building real-time voice and multimodal AI agents now used by NVIDIA, AWS, and thousands of startups worldwide. Her strategic bet: the infrastructure built for human-to-human video calls turns out to be exactly what voice AI agents need.

webrtcvideo-sdkreal-time-aipipecatvoice-aidaily-co
LEGEND!
Pranay Kapadia
PK
PersonFounderExecutive
Pranay Kapadia

Pranay Kapadia is the Co-Founder and CEO of Notable, an AI-powered automation platform for healthcare that eliminates administrative burden for clinicians and health systems. Founded in 2017 after dinner-table conversations with six physician family members - including his psychiatrist wife who called herself 'the highest paid data collector in the world' - Notable has grown to serve 32 million patients across 12,000 sites of care, raised $119.2M in funding including a $100M Series B in 2021, and now automates over one million repetitive healthcare workflows daily. Before Notable, Kapadia helped build Mint.com at Intuit and was on the founding team at Blend, the mortgage fintech unicorn.

aihealthcareautomationfounderceonotable
LEGEND!
Rich Waldron
RW
PersonFounderExecutive
Rich Waldron

Rich Waldron is the Co-founder and CEO of Tray.ai, a San Francisco-based enterprise AI automation and integration platform. He co-founded the company in 2012 out of the UK alongside Alistair Russell and Dominic Lewis, famously surviving 3.5 years without salary by running a web agency, publishing a magazine, and selling shoes on eBay. Under his leadership, Tray.ai has raised $149.1M in funding (most recently a $40M Series C extension in 2022), earned Gartner Visionary recognition in 2024 and 2025, and evolved from an iPaaS provider into an AI-ready enterprise orchestration platform championing the concept of the 'Autonomous Enterprise.'

ceoco-foundertray-aiipaasautomationai-automation
LEGEND!
Ryan Wang
RW
PersonFounderExecutive
Ryan Wang

Ryan Wang is the co-founder and CEO of Assembled, the AI-powered customer support platform trusted by Stripe, Robinhood, and Etsy. A former machine learning engineer at Stripe (employee #80), he co-founded Assembled in 2018 with his brother John Wang and Brian Sze after observing how hard it was to run exceptional support at scale. Assembled has raised $70.7M, including a $51M Series B led by NEA, and now manages contact centers with up to 20,000 agents across chat, email, voice, and workforce management.

ceofounderassembledworkforce-managementcustomer-supportai
FUNDED!
Pipefy
P
San Francisco
CompanySaasEnterprise
Pipefy

Pipefy is an AI-powered, no-code business process automation platform that lets non-developers in finance, HR, procurement, IT and customer service design, run and govern complex workflows. Founded in 2015 by Alessio Alionco in Curitiba, Brazil and now headquartered in San Francisco, it serves thousands of corporate customers in 150+ countries.

2015Founded
San FranciscoHQ
$75MSeries C
workflowbpmno-codeprocess-automationai-agentssaas
FUNDED!
Pylon
P
San Francisco
CompanySaasAi
Pylon

Pylon is the AI-native customer support platform built specifically for B2B companies. It unifies tickets across Slack Connect, Microsoft Teams, Discord, email, and in-app chat into a single inbox, automates routine work with AI agents, and surfaces account-level intelligence for post-sales teams. Backed by a16z, Bain Capital Ventures, General Catalyst, and Y Combinator.

2022Founded
San FranciscoHQ
$31MSeries B
customer-supportb2bai-agentsslack-connectmicrosoft-teamsdiscord
FUNDED!
Sierra
S
San Francisco
CompanyAiEnterprise
Sierra

Sierra is a San Francisco AI company building conversational agents that handle customer interactions for enterprises. Founded by Bret Taylor and Clay Bavor in 2023, it serves more than 40% of the Fortune 50 and was last valued at $15.8 billion after a $950M Series E in May 2026.

2023Founded
San FranciscoHQ
$285M (cumulative)Earlier rounds
ai-agentsconversational-aicustomer-experienceenterprise-aibret-taylorclay-bavor