Pricing
TAGS

Tagged Content

Tagged: enterprise-software

Everything on the platform tagged with enterprise-software.

Browse all tags
saas12machine learning11biotech9supply chain8fintech8oncology6b2b saas5cybersecurity5clinical-stage5medical devices5ai agents4artificial intelligence4logistics4mit-spinout4enterprise software4austin startup4d2c4predictive analytics4healthtech4national security4clean energy4agentic ai3san francisco3mit spinout3enterprise ai3workflow automation3edtech3data science3automation3telehealth3drug-discovery3iot3b2b3drug discovery3generative ai3deep tech3decarbonization3inventory management3ai3y combinator3digital health3precision-medicine3agentic-ai3medical-devices3machine-learning3cpg3circular economy3sustainability3developer tools2foundation models2large language models2cleantech2data centers2predictive maintenance2new york startup2freight forwarding23pl2pallet2tpm today2cargowise2drayage2tribal knowledge2journal of commerce2autonomous vehicles2logistics automation2sensor fusion2clinical research2cambridge2silicon valley2subscription2autoimmune2ai-drug-development2cell-therapy2car-t2vdi2high-performance computing2semiconductors2hypothesis generation2defense2consumer insights2market research2merchandising2back-office automation2bill pay2remote monitoring2new-york2virtual-care2digital-health2augmented reality2mixed reality2precision medicine2aiops2cloud security2crypto2mit2tms2defense tech2aerospace2defense and space2employee benefits2insurtech2benefits administration2health insurance2chicago2immuno-oncology2health tech2adas2genomics2clinical trials2physical ai2human-in-the-loop2saas-platform2subscription app2consumer internet2price optimization2drug-development2environmental services2edge ai2situational awareness2public safety2computer vision2freight2trucking2cancer-immunotherapy2climate tech29111coding agents1ai research1reasoning models1code generation1ai safety1ai unicorn1sculptor1parallel agents1human-centered ai1agi1cooling towers1water recovery1plume abatement1industrial cooling1water sustainability1power plants1ai analytics1waterpanel1towerpulse1electrostatic droplet capture1water conservation1instalily1vertical ai1ai teammates1instaworkers1distribution1erp integration1crm integration1insight partners1series a1coding bootcamp1tech education1web development1data analytics1ux ui design1career change1upskilling1reskilling1remote learning1tech talent1devops1cloud computing1global campuses1spain1miami1container tracking1digital workers1freight tech1self-driving yard trucks1theory of mind ai1yard automation1autonomous trucking1terminal tractors1fleet automation1cambridge startup1mobile security1mobile edr1spyware detection1pegasus1threat hunting1mobile forensics1byod security1ios security1android security1zero-click exploits1executive protection1threat intelligence1smishing protection1mercenary spyware1academic medical center1nonprofit health system1hospitals1philadelphia healthcare1thomas jefferson university1lehigh valley health network1neurosciences1cardiovascular care1graduate medical education1health plan1patient care1pennsylvania1job search1online community1workforce1recruiting1blue-collar jobs1talent acquisition1social networking1career resources1hiring platform1ai job matching1labor market1resume builder1juicero1cold-press juicer1connected hardware1wifi juicer1doug evans1consumer electronics1health and wellness1venture capital1kleiner perkins1google ventures1startup failure1food tech1sparkling water1organizational memory1sushanth raman1eric johnson1technical-interviewing1interviewing-cloud1hiring1hr-tech1engineering-recruitment1interview-engineers1candidate-assessment1predictive-hiring1diversity-hiring1brilliant-black-minds1ai-interviews1remote-interviews1skill-assessment1interviewing-as-a-service1small-molecule1mass-spectrometry1high-throughput-screening1suzhou1adms-platform1ep4-antagonist1preclinical1computer-aided-drug-design1first-in-class1smart-locks1access-control1oem1embedded-firmware1wifi1bluetooth1keyless-entry1smartlock-technology1pcba1cloud-platform1security1denver1colorado1interoperability1transfection1non-viral-gene-delivery1flowfect1electroporation-alternative1biomanufacturing1crispr1mrna-delivery1cell-engineering1immunotherapy1nk-cells1gmp-manufacturing1microfluidics1vector-database1multimodal-ai1lakehouse1lance-format1open-source1data-infrastructure1apache-arrow1rust1embeddings1feature-engineering1ai-training-data1hybrid-search1vector-search1y-combinator1developer-tools1connection broker1remote desktop access1virtual desktop infrastructure1hybrid cloud1zero trust security1desktop as a service1gpu virtualization1linux vdi1vendor-neutral1boston tech1work from anywhere1photonic computing1silicon photonics1optical interconnect1ai accelerator1co-packaged optics1optoelectronic computing1data center1pcie1cxl1optical network-on-chip1nanophotonics1deep learning hardware1lila sciences1scientific superintelligence1autonomous labs1ai for science1ai science factory1self-driving labs1robotic laboratories1materials science1flagship pioneering1automated experiments1green hydrogen catalysts1antibody discovery1cambridge biotech1human risk management1security awareness training1behavior change1phishing simulation1hrm platform1ai-native security1gamification1security culture1insider risk1behavioral analytics1employee training1cyber risk1raw dog food1human-grade dog food1dog nutrition1pet food1ecommerce1dog supplements1frozen raw1pet health1made in usa1dog wellness1freeze-dried treats1magnesium1critical-minerals1clean-tech1electrolysis1seawater1brine1national-security1metallurgy1light-metals1domestic-manufacturing1supply-chain1voice of consumer1product creation1retail tech1synthetic research1ai testing1assortment planning1apparel1footwear1go-to-market1digital twins1product decisions1restaurant technology1restaurant management software1invoice processing1ap automation1recipe costing1food cost control1daily p&l1foodtech1restaurant accounting1pos integrations1pots replacement1telecommunications1managed wireless1lte routers15g connectivity1life safety systems1fire alarm monitoring1enterprise connectivity1cloud platform1copper retirement1carrier agnostic1elevator phones1kitchenware1cookware1sustainable1direct-to-consumer1knives1cutting-board1recycled-plastic1japanese-steel1copper-core1non-toxic1minimalist-design1heirloom1shopify-plus1consumer-goods1amazon ppc1amazon advertising1ecommerce automation1growth automation1amazon sellers1amazon fba1bid optimization1roas1inventory optimization1advertising optimization1ems1emergency-medical-services1community-paramedicine1public-safety1mobile-integrated-healthcare1triage1care-coordination1non-emergency-call-diversion1telemedicine1healthcare-cost-reduction1civic-tech1surgical navigation1medical imaging1xr901omnifyxr1holographic navigation1interventional radiology1image-guided therapy1fda-cleared13d visualization1cleveland clinic1minimally invasive surgery1ultrasound-guided procedures1ge healthcare1ar in healthcare1cloud msp1managed services1aws partner1multi-cloud1digital transformation1cloud migration1south korea1enterprise cloud1ai-native1cloud consulting1finops1meta1meta platforms1facebook1instagram1whatsapp1messenger1threads1reality labs1metaverse1quest1ray-ban meta1smart glasses1virtual reality1llama1meta ai1open source ai1social media1digital advertising1ad tech1mark zuckerberg1menlo park1big tech1pytorch1blockchain1operational intelligence1digital asset risk management1blockchain monitoring1web31analytics1compliance1risk management1network reliability1real-time monitoring1credit building1debit card1gen z finance1ai personal finance1moneygpt1financial wellness1credit score1young adults1student finance1budgeting1no fees1no interest1financial literacy1neobank1consumer finance1immunology1inflammation1fibrosis1human-genetics1data-science1san-diego-biotech1immune-mediated-diseases1mirador3601clinical-pipeline1biopharma1azure virtual desktop1windows 3651microsoft 3651end-user computing1msp automation1cloud management1daas1microsoft intune1cloud cost optimization1nerdio manager1enterprise it1hybrid work1microsoft partner1brain science1neuromodulation1neurotechnology1pbfs1personalized brain functional sectors1depression1parkinsons1alzheimers1autism1brain mapping1neuroimaging1non-invasive1beijing1brain disorders1neuroscience1wealth-management1wealthtech1ria1financial-advisors1sequoia1ex-revolut1inhalation drug delivery1dry powder nebulizer1dryneb1respiratory therapy1lung disease1medical device1biotechnology1pulmonary medicine1high-dose lung delivery1drug delivery technology1albuquerque biotech1new mexico startup1respiratory infections1inhalation therapy device1hardware testing1mission-critical data1industrial data platform1sensor data1telemetry1edge computing1data observability1hardware-in-the-loop1test automation1dual-use1data infrastructure1engineering software1ground stations1phased array1satellite communications1space infrastructure1ground segment1el segundo1space force1satellite networks1ground network1rf hardware1space data1digital beamforming1scalable ground stations1cancer-detection1bioimpedance1cole-relaxation-frequency1point-of-care1ai-diagnostics1mohs-surgery1biopsy1surgical-margins1medtech1real-time-diagnostics1chicago-startup1marginscan1nscanary1benefits data platform1insurance technology1benefits api1carrier connectivity1benefitsos1api-first1data accuracy1enrollment automation1metal-organic-frameworks1mof1advanced-materials1chemical-separation1semiconductor1chemistry1nanotechnology1gas-storage1decontamination1precision-chemistry1materials-science1industrial-manufacturing1super-resolution microscopy1single-molecule imaging1nanoimager1life sciences1extracellular vesicles1lipid nanoparticles1drug delivery1oxford spinout1codi cloud platform1dstorm1single-molecule localization1nanoparticle analysis1scientific instruments1oral health1dental technology1smart toothbrush1intraoral imaging1teledentistry1consumer health1prophix1preventive care1dental innovation1video toothbrush1hipaa1identity security1access management1iam1identity governance1just-in-time access1least privilege1privileged access management1non-human identity1agentic ai security1policy-as-code1zero trust1access reviews13d-printing1additive-manufacturing1roll-to-roll1computational-design1metamaterials1cosmetics1micro-mesh1mass-customization1materials-foundry1polymer-development1ramp1instaswab1lumofil1digital-manufacturing1usage-based billing1billing infrastructure1revenue management1pricing1saas billing1metering1invoicing1revenue recognition1ai billing1consumption pricing1san francisco startup1autonomous-vehicles1adas-validation1automotive-ai1sensor-fusion1big-data1data-distillation1physical-ai1kpi-automation1homologation1euro-ncap1regression-testing1validation-automation1automotive-software1waltham1b2b-saas1ocean energy1wave energy1marine renewable energy1offshore power1ai data centers at sea1ocean compute1autonomous nodes1public benefit corporation1portland oregon1renewables1ai inference1deep sea energy1terawatt scale1scidb1reveal1life-sciences1multi-omics1biobank1uk-biobank1scientific-data-management1array-database1computational-biology1multimodal-data1translational-informatics1ai-validation1patient-reported outcomes1healthcare analytics1ehr integration1real-world evidence1patient engagement1biostatistics1health systems1med tech1outcomes data1chicago startups1pattern discovery1high-dimensional data1explainable ai1medical diagnostics1healthcare ai1reagent-free testing1raman spectroscopy1friday harbor1robotics1truck unloading1warehouse automation1machine vision1material handling1robotic manipulation1autonomy1distribution centers1industrial robotics1labor automation1no-code ai1nlp1model fine-tuning1content moderation1document intelligence1risk detection1customer insights1on-premise ai1data sovereignty1ai interpretability1experiential-learning1work-integrated-learning1internships1industry-projects1eportfolio1micro-credentialing1employability1higher-education1learning-analytics1ai-feedback1project-based-learning1virtual-internships1mentoring1faith app1daily prayer1bible audio1bedtime bible stories1celebrity narrators1christian community1faith-based media1prayer app1audio streaming1religious content1spiritual growth1los angeles startup1wine ai1spirits ai1beer recommendations1personalization platform1recommendation engine1b2b2c1taste matching1beverage technology1product discovery1consumer preferences1napa valley1retail personalization1sensory data1microschools1education1k-81homeschooling alternative1school choice1personalized learning1mastery-based learning1project-based learning1student-centered1guides1empowered learners1tuition-free1esa1arizona1pricing software1cpq1rebate management1ai pricing1b2b enterprise software1cloud-native saas1price management1price analytics1dynamic pricing1margin improvement1sap partner1salesforce appexchange1pricingai1retail ai1assortment optimization1demand forecasting1competitive intelligence1decision intelligence1retail analytics1pittsburgh startup1house cleaning1home services1on-demand1quick commerce1household help1india1bengaluru1gig work1domestic work1subscription cleaning1instant booking1verified professionals1women workforce1consumer app1startup1digital media1journalism1subscription newsletter1creator economy1insider news1hollywood1washington1wall street1journalist ownership1media startup1podcasts1premium content1political analysis1entertainment news1geothermal1deep-geothermal1millimeter-wave-drilling1gyrotron1clean-energy1renewable-baseload1superhot-rock1energy-transition1fusion-tech1drilling-technology1carbon-free-power1qualitative research1smart sensors1usage intelligence1ai analysis1mobile ethnography1product innovation1video insights1behavioral data1iot sensors1usesights1shopper insights1quantum network1quantum-safe communication1fiber optics1coherent optical network1quantum key distribution1qkd1midwest quantum ecosystem1indiana1infrastructure1low latency1public-private partnership1quantum computing1spend management1corporate cards1expense management1accounts payable1finance automation1ai finance1procurement1travel management1treasury1financial operations1fetal monitoring1fetal pulse oximetry1lumerah1maternal health1obstetrics1cesarean reduction1biophotonics1fda breakthrough device1noninvasive sensor1womens health1childbirth1femtech1pharmaceuticals1hdac-inhibitors1ricolinostat1diabetic-neuropathy1hdac61massachusetts1rare-disease1neuropathy1protein-acetylation1renewance1battery lifecycle management1industrial batteries1battery energy storage1bess1battery recycling1ev batteries1lithium-ion1battery stewardship1decommissioning1renewanceconnect1elmhurst illinois1probiotics1prebiotics1postbiotics1gut health1microbiome1gut-lung axis1gut-x axis1lung health1dietary supplements1physician developed1science backed supplements1metabolic health1respiratory health1transcription1captions1subtitles1speech-to-text1asr1automatic-speech-recognition1legal-tech1diarization1reverb1rev-ai1freelance-marketplace1remote-work1accessibility1api1deposition-summaries1ediscovery1meeting-notes1enterprise-speech-api1defense technology1tactical edge1geospatial intelligence1biometrics1offline intelligence1military software1drone mapping1uas data processing1decision dominance1veteran-founded1revenue intelligence1sales engagement1guided selling1salesforce-native1sales analytics1revenue operations1ai sales assistant1pipeline management1sales forecasting1activity capture1crm automation1sales enablement1deal intelligence1generative signals1enterprise-ai1legacy-modernization1business-logic1digital-transformation1logic-graph1universal-application-notation1koch-disruptive-technologies1washington-dc1technical-debt1application-development1system-of-record1motorcycle rental1peer-to-peer1motorcycle sharing1marketplace1harley rentals1motorsport1sharing economy1insurance1roadside assistance1rider pass1two-wheel mobility1travel1sleep1sleep tracker1energy1circadian rhythm1sleep debt1wellness1productivity1chronobiology1mobile app1performance1non-emergency medical transportation1nemt1healthcare transportation1medicaid1medicare advantage1patient access1health equity1social determinants of health1fleet management1ride scheduling1healthcare logistics1san antonio1care access1mobility management1space domain awareness1space situational awareness1sda sensors1satellite sensors1autonomy software1edge processing1rendezvous proximity operations1space debris1orbital intelligence1leo geo sensors1space safety1us space force1blue origin1national security space1wearable ultrasound1noninvasive neuromodulation1bioelectronic medicine1anti-inflammatory therapy1rheumatoid arthritis1low-intensity focused ultrasound1splenic ultrasound1bio-ultrasonic medicine1long covid1chronic inflammation1drug-free therapy1minneapolis medtech1darpa funded1series a startup1stablecoins1cross-border-payments1remittances1eusd1self-custodial-wallet1mobilecoin1p2p-payments1mobile-payments1freelancer-payments1sentz-earn1digital-dollar1global-payments1transportation management1ai in logistics1real-time visibility1freight automation1shipping1supply chain visibility1il-181engineered-cytokines1decoy-resistant-il-181solid-tumors1directed-evolution1new-haven1yale-spinout1small business1payroll integration1online insurance quotes1medical dental vision1brokers1smb1engagement-as-a-service1edge-computing1smart-mesh1behavior-intelligence1predictive-analytics1white-label-apps1seattle-startup1aws-co-founder1rapid-application-development1smart-stadiums1retail-iot1dispatch1owner-operators1small-fleets1load-board1ai-dispatch1trucking-software1fuel-card1route-optimization1spot-market1miami-startup1transportation1solar panel recycling1solar glass manufacturing1materials recovery1renewable energy1solar waste1end-of-life solar1domestic supply chain1satellite communication1mesh networking1atak plugin1edge networking1tactical communications1jadc21off-grid1blue uas1software-defined network1satcom1first responders1telesurgery1remote-surgery1robotic-surgery1surgical-robotics1health-tech1low-latency1healthcare-it1surgical-access1santa-barbara1series-b1food waste1surplus inventory1liquidation1managed marketplace1food recovery1waste diversion1perishables1pricing intelligence1secondary market1no-code1llm orchestration1agent builder1rag1enterprise search1ai governance1soc 21document processing1asana acquisition1rna epigenetics1epitranscriptomics1mettl3 inhibitor1stc-151cambridge uk1rna modifications1small molecule1cancer therapeutics1mass spectrometry1mrna1programmable-mrna1synthetic-biology1rna-therapeutics1il-121self-replicating-mrna1genetic-medicine1gene-circuits1cambridge-biotech1mlops1ai operations1model deployment1defense ai1model monitoring1data lineage1model governance1responsible ai1chariot platform1automatic target recognition1austin texas1model drift1ml lifecycle1b2b software1metal recycling1swarf recycling1clean industry1metal manufacturing1co2-free recycling1on-site recycling1industrial decarbonization1aluminum recycling1steel recycling1venus-l61electromagnetic heating1surgical quality1second opinion1surgeon outcomes1ai in surgery1ambulatory surgery1employer benefits1medical records1risk-adjusted outcomes1surgigpt1healthcare1rockville maryland1no-code analytics1augmented analytics1conversational ai1manufacturing intelligence1industrial ai1digital twin1jarvix1automl1business intelligence1industry 4.01factory analytics1data integration1ev financing1climate1electric vehicles1auto loans1embedded lending1credit unions1lending-as-a-service1ev finance1auto finance1terahertz1automotive sensors1all-weather radar1lidar alternative1solid-state sensor14d imaging1vehicle safety1boston startup1silicon chip1self-driving1
Often tagged with
Showing 29 results for enterprise-software
Sort:
LEGEND!
Ryan Janssen
RJ
PersonFounderExecutive
Ryan Janssen

Ryan Janssen is the Co-founder and CEO of Zenlytic, a New York-based AI-powered business intelligence platform that lets non-technical users query data in plain English. A former McKinsey consultant and 6-year venture capital investor with advanced degrees from Harvard and Oxford, Ryan co-founded Zenlytic in 2020 alongside CTO Paul Blankley after spotting a gap: companies had modern data infrastructure but no accessible way to use it. Zenlytic has raised $15.4M including a $9M Series A in 2024 led by M13, and its AI analyst Zoe can now onboard itself autonomously to any data warehouse.

aibusiness-intelligencesaasdata-analyticsstartup-ceoventure-capital
FUNDED!
Airtable
A
San Francisco
CompanySaasAi
Airtable

Airtable is a San Francisco software company that turned the humble spreadsheet into a flexible app platform, letting non-engineers build relational databases, interfaces, and automated workflows without code. Founded in 2012 and launched publicly in 2015, it now serves more than 500,000 organizations - including the majority of the Fortune 100 - and has refounded itself as an AI-native app platform anchored by its conversational builder, Omni.

2012Founded
San FranciscoHQ
$735MSeries F
airtableno-codelow-codeapp-platformrelational-databasespreadsheet-database
FUNDED!
B
CompanyAiSaas
BetterUp

BetterUp is a San Francisco-founded human transformation company that pairs certified human coaches, behavioral science, and AI to deliver personalized professional and leadership development at enterprise scale. It coaches employees at hundreds of companies and government agencies, blending one-on-one coaching, assessments, and data-driven insights, and has increasingly moved toward AI-powered coaching that runs around the clock.

2013Founded
San FranciscoHQ
~$189,900 (latest, reported)Other
coachingprofessional-coachingexecutive-coachingai-coachingleadership-developmentbehavioral-science
FUNDED!
Freshworks
F
San Mateo
CompanySaasEnterprise
Freshworks

Freshworks is a cloud-based business software company that builds easy-to-use customer service, IT service management and CRM tools for companies that found legacy enterprise software too complicated and too expensive. Founded in Chennai in 2010 as Freshdesk, it became the first India-born SaaS company to list on Nasdaq in 2021 and now serves tens of thousands of customers worldwide with an AI assistant, Freddy, woven through its products.

2010Founded
San MateoHQ
$1.03BIPO (Nasdaq: FRSH)
saascustomer-service-softwareitsmcrmhelpdeskfreddy-ai
FUNDED!
GitLab
G
San Francisco
CompanyDeveloper ToolsSaas
GitLab

GitLab is an AI-powered DevSecOps platform that brings the entire software development lifecycle - planning, source code management, CI/CD, security, and deployment - into a single application. Born as an open-source alternative to GitHub in 2011 and run as one of the world's largest all-remote companies, GitLab now serves enterprises and millions of developers, trades on Nasdaq under GTLB, and is pushing into agentic AI development with GitLab Duo.

2011Founded
San FranciscoHQ
~$800M raised at $77/shareIPO
gitlabdevsecopsdevopsdeveloper-toolsversion-controlgit
FUNDED!
New Relic
NR
San Francisco
CompanySaasDeveloper Tools
New Relic

New Relic is a San Francisco-based, AI-powered observability platform that gives engineering teams a single place to see everything running in their software - from application code and infrastructure to logs, user experience, and AI models. Founded in 2008 by Lew Cirne, it helped popularize application performance monitoring (APM) and later coined much of the modern 'observability' category. After going public in 2014 and being taken private in a $6.5 billion deal in 2023, New Relic now serves thousands of companies with usage-based, consumption pricing and a strong bet on AI and agentic observability.

2008Founded
San FranciscoHQ
$6.5BTake-private acquisition
observabilityapmapplication-performance-monitoringmonitoringdevopsaiops
LEGEND!
Ashraf Karim
AK
PersonExecutiveOperator
Ashraf Karim

Ashraf Karim is Senior Vice President of Connected Customer Experiences & Technology at ServiceNow, where he leads the charge on transforming how enterprises engage customers through AI-powered digital workflows. With over two decades spanning engineering, product management, and executive leadership at Google, PayPal, Affirm, and Cisco, Karim bridges the gap between deep technical fluency and strategic business thinking. He is known for championing simplicity-first design, advocating that reducing cognitive load at every customer touchpoint is the defining discipline of great product leadership.

servicenowsvpproduct-managementcustomer-experienceenterprise-softwareai
FUNDED!
Monday CRM
MC
Tel Aviv
CompanySaasEnterprise
Monday CRM

Monday.com is a publicly traded Israeli SaaS company (NASDAQ: MNDY) that builds a Work OS platform used by 245,000+ organizations globally. Its flagship products include Monday CRM, Monday Dev, and Monday WorkOS — a suite of customizable tools for sales, project management, and team collaboration. Founded in 2012, the company has grown from an internal Wix.com tool to a $1B+ ARR business with AI-powered agents, workflow automation, and deep integrations with 200+ enterprise tools.

2012Founded
Tel AvivHQ
$574MIPO (NASDAQ: MNDY)
crmproject-managementwork-ossaascollaborationautomation
LEGEND!
Anand Tharanathan
AT
PersonExecutiveOperator
Anand Tharanathan

Anand Tharanathan is Group Vice President and Global Head of Product Research and Insights at ServiceNow, where he leads end-to-end user research and AI trust initiatives for one of enterprise software's fastest-growing platforms. With a Ph.D. in Experimental Psychology, an MBA from Northwestern's Kellogg School, and a career that runs from Honeywell's aerospace labs through Facebook to the frontier of enterprise AI, he bridges rigorous science and product craft at scale. His current focus on building trust in generative AI systems puts him at the intersection of human factors research and the most pressing question in enterprise technology.

user-experienceproduct-researchhuman-factorsgenerative-aiai-trustservicenow
LEGEND!
Allison Blais
AB
PersonExecutiveOperator
Allison Blais

Allison Blais is Vice President of Business & Strategic Operations and Chief of Staff to Adobe President David Wadhwani, running day-to-day operations of Digital Media - Adobe's largest business unit. A lawyer-turned-operator, she transitioned from 15+ years in financial services and corporate law into driving strategy for Creative Cloud, Document Cloud, and Adobe Firefly, the company's generative AI platform. Her path from FINRA regulatory analyst to VP at one of the world's most influential software companies is a masterclass in reinvention.

adobedigital-mediacreative-clouddocument-cloudchief-of-staffvp-operations
LEGEND!
AJ Herrera
AH
PersonExecutiveOperator
AJ Herrera

AJ Herrera is the VP of Corporate Marketing at Cloudflare, where he leads the brand narrative that recast a CDN company into the world's connectivity cloud. With over 30 years in high-tech marketing spanning Silicon Graphics, a decade running his own agency, and seven years shaping VMware's global brand, he brings both the craftsman's instinct and the operator's eye to one of the internet's most consequential infrastructure companies.

cloudflarecorporate-marketingbrand-strategyvp-marketingtech-marketingenterprise-software
FUNDED!
Oracle Sales Cloud
OS
Austin
CompanySaasEnterprise
Oracle Sales Cloud

Oracle Sales Cloud (CX Sales) is Oracle's enterprise-grade cloud CRM platform that combines sales automation, AI-driven forecasting, configure-price-quote (CPQ), and subscription management into a single suite. Built on Oracle Fusion Cloud, it connects directly with Oracle ERP and supply chain data, letting sales teams quote accurately, close faster, and forecast confidently - without the integration tax that plagues competing platforms. With 5,500+ enterprise customers and $57.4 billion in annual parent revenue, Oracle Sales Cloud targets large organizations that demand reliability, data depth, and AI at scale.

1977Founded
AustinHQ
crmsales-automationenterprise-softwarecloud-computingaicpq
FUNDED!
Sage CRM
SC
Newcastle upon Tyne
CompanySaasEnterprise
Sage CRM

Sage CRM is a customer relationship management platform built by Sage Group plc, designed to help small and mid-sized businesses manage sales pipelines, marketing campaigns, and customer service from a single hub. Deeply integrated with Sage's accounting suite, it lets growing companies turn contact records into revenue without the complexity - or cost - of enterprise alternatives like Salesforce.

1981Founded
Newcastle upon TyneHQ
crmcustomer-relationship-managementsaassmbsalesmarketing
FUNDED!
Salesforce
S
San Francisco
CompanyEnterpriseSaas
Salesforce

Salesforce is the world's leading customer relationship management (CRM) platform, connecting companies and their customers across sales, service, marketing, and commerce. Founded in 1999 by Marc Benioff and co-founders in a San Francisco apartment, the company pioneered cloud-based enterprise software and has since expanded into a full AI-powered platform - Agentforce 360 - serving over 150,000 organizations worldwide, including 90% of the Fortune 500. With $41.5 billion in FY2026 revenue and a market-dominant 21% share of the global CRM industry, Salesforce is reshaping how companies deploy autonomous AI agents to run their operations.

1999Founded
San FranciscoHQ
$110 millionIPO
crmenterprise-softwarecloudaisaassales
FUNDED!
Creatio
C
Boston
CompanySaasEnterprise
Creatio

Creatio is a Boston-based enterprise software company that builds an AI-native, no-code CRM and workflow automation platform. Founded in 2002 (originally as bpm'online) and rebranded in 2019, Creatio achieved unicorn status in 2024 with a $1.2 billion valuation after raising $200 million in Series B funding. The platform serves 7,000+ customers across 100 countries in 23 languages, enabling organizations to automate business workflows and manage customer relationships without writing code. With 45% year-over-year growth in 2024, Creatio competes against Salesforce and Microsoft Dynamics by offering faster implementation, composable pricing, and deeply integrated agentic AI capabilities across its Sales, Marketing, and Service modules.

2002Founded
BostonHQ
$4.78 millionSeries D
crmno-codelow-codeworkflow-automationbpmai
LEGEND!
Devasena Rajamohan
DR
PersonExecutiveEngineer
Devasena Rajamohan

Devasena Rajamohan is Corporate Vice President of Dynamics 365 Customer Experience Applications at Microsoft, leading global teams of product managers, engineers, and data scientists driving innovation across Customer Insights, Sales, Customer Service, and Copilot. With a career spanning over two decades in enterprise CRM and cloud software—including senior leadership at SAP and early engineering roles at TATA Infotech—she has shaped how large organizations deliver AI-powered customer engagement. Under her leadership, Microsoft earned recognition as a Leader in both the 2025 Gartner Magic Quadrant for CRM Customer Engagement Center and The Forrester Wave Customer Service Solutions Q1 2026.

microsoftdynamics-365crmcustomer-experiencecorporate-vice-presidententerprise-software
LEGEND!
DM
PersonExecutiveOperator
Diya Mathew

Diya Mathew is a Senior Manager for Customer Engagement Strategy in the Office of the President & COO at ServiceNow, the enterprise cloud platform company valued at over $100 billion. A graduate of Duke University's Fuqua School of Business and NIT Tiruchirappalli, she brings a rare blend of technical depth and strategic acumen forged across Cisco, Deloitte Consulting, Meta, and now ServiceNow. Based in San Francisco, she works at the intersection of executive strategy, customer engagement, and enterprise operations.

servicenowcustomer-engagementstrategyenterprise-saasmetadeloitte
LEGEND!
DP
PersonExecutiveOperator
Douglas Pearce

Douglas Pearce is Corporate Vice President of Product Management for M365 Copilot Growth at Microsoft, where he leads the strategy to bring AI-powered productivity tools to hundreds of millions of users worldwide. Based in the Seattle area, he has spent over two decades at Microsoft, previously heading product management for Office Growth and Fundamentals before pivoting to spearhead the company's flagship AI copilot initiative across Microsoft 365.

microsoftm365copilotproduct-managementaicloud
LEGEND!
EB
PersonExecutiveOperator
Eric Bensley

Eric Bensley is VP of Product Marketing - CRM at ServiceNow, bringing over 25 years of experience in CRM solutions and enterprise software marketing. A self-described 'recovering perfectionist' and introvert who built product marketing functions at Citrix, Salesforce, and Asana before joining ServiceNow, he is known for translating complex enterprise platforms into crisp, sticky messaging - and for believing that great leaders grow people, not just products.

product-marketingcrmservicenowsaasb2benterprise-software
LEGEND!
GK
PersonExecutiveOperator
Gavin King

Gavin King is VP of Portfolio Marketing at ServiceNow, where he connects the platform's sprawling product launches, AI vision, and strategic narrative into one coherent story. After 25 years at Microsoft - including a stint as Chief of Staff to CEO Satya Nadella - he brings a rare combination of brand-scaling experience, executive proximity, and B2B marketing depth to one of enterprise tech's most ambitious growth stories.

marketingportfolio-marketingbrand-strategyenterprise-softwareservicenowmicrosoft
LEGEND!
GM
PersonExecutiveOperator
Goran Mehinovic

Goran Mehinovic is AVP of Customer Growth at Adobe, based in Lehi, Utah, where he focuses on helping enterprise customers maximize their return on Adobe Workfront investments. With a background spanning financial services and enterprise SaaS, he bridges customer success with revenue expansion across Adobe's work management platform. His career trajectory from financial services representative to senior Adobe executive reflects a consistent focus on client relationship management and growth in high-stakes enterprise environments.

adobeworkfrontcustomer-growthcustomer-successsaasenterprise-software
LEGEND!
Jason Neubert
JN
PersonExecutiveOperator
Jason Neubert

Jason Neubert is AVP Sales - Data & Insights at Adobe, based in Lehi, Utah, where he leads sales efforts around Adobe's analytics and data intelligence portfolio — including Customer Journey Analytics, Adobe Analytics, and the B2B Edition suite. With over 15 years at Adobe, he has climbed through account executive, senior manager, and regional VP roles, building a reputation for translating complex data products into measurable business outcomes for enterprise buyers. Off the clock, he's a championship-winning volleyball coach whose teams at Lone Peak High School and Utah Reign Volleyball Club claimed multiple state and regional titles.

adobesalesdata-insightscustomer-journey-analyticssaasb2b-sales
LEGEND!
JP
PersonExecutiveOperator
JD Price

JD Price is the AVP of Customer Growth for Adobe Experience Cloud, based in South Jordan, Utah. A decade-plus Adobe veteran, he built his career climbing every rung of Adobe's sales ladder - from Account Development Manager to Enterprise Account Executive to his current leadership role overseeing customer growth strategy for Adobe's flagship enterprise marketing platform. Before Adobe, he worked in collateral management at Goldman Sachs and State Street, bringing a finance-world precision to the art of enterprise customer acquisition.

adobeexperience-cloudcustomer-growthsaasb2b-marketingdigital-marketing
LEGEND!
Jennie Strobeck
JS
PersonExecutiveOperator
Jennie Strobeck

Jennie Strobeck is AVP of State & Local Sales, Digital Media at Adobe, where she leads government sales strategy across city, county, and state agencies. With a career spanning enterprise tech sales at DLT Solutions, immixGroup, and Avaya Government Solutions, she has spent over two decades at the intersection of technology and public sector transformation. At Adobe, she previously served as Chief of Staff and Channel Sales Manager before stepping into the AVP role in 2022. She is particularly focused on digital accessibility, helping governments meet DOJ WCAG compliance requirements and modernize document workflows at scale.

adobestate-and-local-governmentdigital-mediasalespublic-sectoraccessibility
LEGEND!
JB
PersonExecutiveOperator
Jennifer Burke

Jennifer Burke is an Area Vice President for Digital Experience in the Media & Entertainment vertical at Adobe, where she leads enterprise sales and customer engagement for one of the company's most competitive industry segments. Based in Gainesville, Georgia, she brings over three decades of high-stakes commercial experience spanning retail, CPG, and enterprise technology - from rising through Catalina USA's brand development ranks to closing strategic accounts at Microsoft before joining Adobe's go-to-market machine. She is currently at the sharp edge of Adobe's push into agentic AI, championing AI-driven customer experience products to some of the largest media and entertainment companies in the world.

adobedigital-experiencemedia-entertainmentvice-presidentmarketingagentic-ai
LEGEND!
JA
PersonEngineerOperator
Jon Alexander

Jon Alexander is a technology professional at Google, one of the world's most influential technology companies. Based in Woodinville, Washington, he works within Google's vast ecosystem spanning cloud infrastructure, AI, software development, and internet services. His LinkedIn handle 'jonpalexander' and presence on Twitter reflect an individual embedded in the cutting edge of modern technology, operating from one of the Pacific Northwest's growing tech communities near Seattle.

googletechnologysoftwarecloudaimachine-learning
LEGEND!
JM
PersonExecutiveOperator
Jonathan Manalo

Jonathan Manalo is VP of Growth at Microsoft, operating from Central Luzon, Philippines. In this role he drives commercial expansion across one of the world's most influential technology companies - a company whose annual revenue exceeds $281 billion and whose technologies power enterprises from startups to sovereign governments. Based in the Philippines, Manalo sits at the intersection of Microsoft's deep enterprise portfolio - Azure, Microsoft 365, Copilot, and Dynamics 365 - and the rapidly digitizing Southeast Asian market.

microsoftgrowthtechnologyphilippinescloud-computingartificial-intelligence
LEGEND!
JC
PersonExecutiveOperator
Joshua Christensen

Joshua Christensen is the AVP of Customer Growth at Adobe, based in Salt Lake City, Utah. With a career spanning nearly two decades in enterprise software sales and business development, he has grown from frontline sales roles at companies like Workfront to senior leadership at one of the world's largest digital media and marketing technology companies. He holds an MBA from Westminster College and a BASc from the University of Utah, combining formal business education with deep SaaS industry expertise. Colleagues describe him as a results-driven leader who genuinely invests in developing the people around him.

adobecustomer-growthavpsaassalesmarketing
LEGEND!
JP
PersonExecutiveOperator
Julie Poutre

Julie Poutre is Vice President of Americas Field Marketing at Twilio, the cloud communications platform behind a significant portion of the world's digital interactions. Based in San Francisco, she leads the regional field marketing operation that drives pipeline and revenue across the Americas. Over nearly a decade at Twilio, she has risen from Senior Manager through Director and Senior Director roles to her current VP position, building one of the most sophisticated field marketing engines in enterprise SaaS. Before Twilio, she spent nearly a decade at Infoblox — moving from global events coordinator to Sr. Channel Programs Manager — where she honed the craft of building partner programs and generating qualified sales leads at scale.

field-marketingb2b-marketingtwiliosaascloud-communicationsvp-marketing