Pricing
TAGS

Tagged Content

Tagged: seed-investor

Everything on the platform tagged with seed-investor.

Browse all tags
b2b saas14saas12b2b11digital health10fintech9d2c9machine learning8biotechnology7telehealth7ai7climate tech7wellness6proptech6decarbonization5enterprise ai5supply chain4value-based care4remote patient monitoring4biotech4agentic ai4food and beverage4ecommerce4healthtech4real estate technology4reinforcement learning4sustainability4developer tools4oncology4medical devices4circular economy4precision medicine3ai logistics3hr tech3developer-tools3ai agents3new york startup3chronic disease management3y combinator3san francisco startup3clinical trials3computer vision3robotics3real-world-assets2rwa2defi2blockchain2crypto2drug development2personalized medicine2claims management2enterprise software2usage-based pricing2virtual care2femtech2endometriosis2clinical-stage2neuroscience2cell therapy2immuno-oncology2solid tumors2immunotherapy2holistic health2gut health2primary care2mobile app2dtc2direct-to-consumer2shopify2social determinants of health2care navigation2population health2lead generation2financial inclusion2energy efficiency2deepmind alumni2longevity23d printing2b2b software2london startup2earned wage access2api integration2workflow automation2workday2carbon accounting2functional mushrooms2adaptogens2plant-based2lions mane2cordyceps2reishi2immune support2proteomics2data analytics2marketing automation2heart failure2multiple sclerosis2healthcare technology2continuous monitoring2leak detection2regulatory compliance2iot sensors2energy2manufacturing2generative ai2ai infrastructure2clinical-stage biotech2precision oncology2deep tech2eda2semiconductors2clean energy2healthcare analytics2employee benefits2inventory management2wearable robotics2exoskeleton2assistive technology2aerospace2deep learning2cleantech2gene therapy2fashion tech2palo alto startup2edtech2carbon reduction2defense tech2ai for finance2vegan2new york2e-commerce2subscription2insurtech2drug discovery2ai healthcare2tokenization1tokenized-treasuries1stablecoin1ousg1usdy1ondo-chain1institutional-defi1on-chain-securities1asset-management1tokenized-stocks1yield1canine cancer1veterinary oncology1comparative oncology1ai in veterinary medicine1genomic testing1targeted therapy1dog cancer1real-world evidence1biomarker discovery1animal health1clinico-genomics1auto protection1community insurance1insurance alternative1mutual aid1collision coverage1comprehensive coverage1shared risk1depin1olt token1safe driving rewards1vehicle protection1ai damage assessment1auto insurance alternative1last mile delivery1delivery orchestration1logistics technology1omnichannel fulfillment1courier network1same-day delivery1route optimization1multi-carrier management1real-time visibility1logistics as a service1final mile1dynamic fulfillment1carrier network1delivery automation1orlando startup1upskilling1reskilling1learning and development1corporate training platform1skills management software1ai in hr1talent development1employee development platform1learning marketplace1skills gap analysis1hris integration1workforce upskilling1skills-first1professional development1microlearning1learning analytics1internal mobility1bitcoin1lightning-network1bitcoin-payments1payment-processor1crypto-payments1payouts1payment-gateway1bitcoin-api1hosted-checkout1in-person-payments1currency-conversion1settlement1ecommerce-plugins1merchant-payments1instant-settlement1pelvic health1pelvic floor physical therapy1womens health1physical therapy1postpartum care1menopause1insurance covered pt1painful sex1pelvic organ prolapse1bladder control1diastasis recti1trauma-informed care1evidence-based care1healthcare1cell-therapy1parkinsons-disease1neuron-replacement1ipsc1dopaminergic-neurons1neurodegenerative1autologous1regenerative-medicine1stem-cells1virtual gi care1digestive health1gastroenterology1ibs1ibd1crohns disease1ulcerative colitis1gerd1multidisciplinary care1gut-brain1behavioral health integration1registered dietitian1virtual specialty care1center of excellence1health plan partnerships1whole-person care1osmo1digital olfaction1ai scent1olfactory intelligence1scent teleportation1fragrance ai1principal odor map1smell digitization1molecular discovery1graph neural networks1aroma molecules1alex wiltschko1google brain spinout1generation by osmo1scent design1ostium1perpetuals1perps1decentralized-exchange1dex1arbitrum1onchain-trading1commodities1forex1stocks1indices1synthetic-assets1leverage1self-custody1tradfi1protein design1ai protein design1car t cells1synthetic biology1de novo proteins1cytokines1cancer treatment1seattle biotech1programmable proteins1music production software1virtual instruments1audio plugins1sound design1ai music1arcade1co-producer1sample library1vst plugins1music technology1daw1royalty-free samples1music creation1los angeles startup1summit partners1ai cybersecurity1brand protection1digital threat detection1impersonation removal1phishing detection1deepfake detection1threat intelligence1automated threat response1scam takedown1executive protection1soar integration1siem integration1open-source intelligence1digital trust1boozy tea1hard tea1canned cocktails1spiked pop1hard soda1tea cocktails1real ingredients1low sugar alcohol1low calorie1women-led1tea sommelier1botanicals1ready-to-drink1craft beverage1responsible drinking1legal software1legal tech1ediscovery1social media evidence1web capture1digital evidence1chain of custody1court admissibility1website archiving1metadata and hashing1affidavit generation1litigation support1evidence preservation1remote browsing1legal services1pizza1restaurants1new england1thin-crust pizza1quick service1massachusetts1pizzeria1italian food1dedham1regional chain1family restaurant1postgres1search1full-text-search1bm251analytics1olap1elasticsearch-alternative1open-source1database1tantivy1rust1pg_search1acid1opensearch1functional medicine1telemedicine1root-cause medicine1autoimmune care1hormonal health1metabolic health1preventive medicine1lab testing1biomarker testing1health coaching1nutrition1membership healthcare1women's health1lifestyle medicine1event planning1online invitations1rsvp tracking1party planning1guest management1evite alternative1gen z1consumer social1ticketing1birthday invites1text message invites1event management1social events1andreessen horowitz1healthcare financing1patient financing1point-of-sale financing1medical aesthetics1elective procedures1buy now pay later1bnpl healthcare1plastic surgery financing1dental financing1fertility financing1lasik financing1soft credit check1practice management1monthly payment plans1patient affordability1pattern-brands1home-goods1consumer-brands1brand-aggregator1brand-acquisition1kitchen-tools1home-organization1home-decor1gin-lane1new-york1multi-brand-platform1consumer-products1brand-building1community health workers1chw1sdoh1care management1medicaid billing1health plans1promotores1doulas1case management1ai workflows1community-based organizations1referral management1b2b data1data enrichment1people data1company data1data as a service1daas1developer apis1person enrichment1company enrichment1data provider1sales intelligence1identity resolution1data science1professional profiles1ip enrichment1job posting data1big data1api1relocation1global mobility1ai home search1employee relocation1immigration1visa support1destination services1relocation management1expense management1mobility platform1corporate relocation1international relocation1mls platform1residential real estate1data and workflow platform1market analytics1agent productivity1listing management1client collaboration1reso certified api1real estate data1new york city real estate1ai property descriptions1diabetes management1type 2 diabetes1connected glucose meter1blood glucose monitoring1medicare1doctor-led care1senior health1at-home diabetes care1personalized coaching1asset-backed credit card1secured credit card1pawn alternative1credit building1underbanked1mastercard1consumer lending1collateral lending1industrial ai1data center cooling1ai control systems1autonomous control1virtual plant operator1ai factories1mission critical facilities1closed-loop control1pue reduction1self-learning ai1liquid cooling1chiller plant optimization1body composition1mri1medical imaging1radiomics1phenotyping1quantified self1whole-body imaging1digital physical exam1accessible imaging1physna1thangs13d search1geometric search1geometric deep learning13d model search engine1object dna1cad1intellectual property protection1manufacturing software1enterprise saas1columbus ohio1adtech1digital advertising1social display1user-first advertising1mobile advertising1sustainable advertising1carbon neutral ads1publisher monetization1programmatic1ad formats1attention metrics1open web1creative optimization1inventory quality1pinwheel1payroll api1income verification1direct deposit switch1deposit switching1account activation1switch kit1primacy1bill switching1payroll data connectivity1real-time income data1fcra compliance1consumer reporting agency1banking technology1open banking1credit unions1neobanks1pipedream1serverless1mcp servers1model context protocol1no-code automation1low-code1integration platform1ipaas1connect sdk1lifecycle assessment1ghg inventory1scope 3 emissions1net zero1climate software1consumer products1cpg1carbon labels1science based targets1supplements1mushroom gummies1vegan supplements1nootropics1b corporation1climate neutral1herbal supplements1clean label1brain health1sleep support1austin1texas1gummy vitamins1agentic-ai1code-simulation1software-quality1predictive-software-quality1ai-debugging1enterprise-software1codesim1sim-11engineering-productivity1bug-prevention1ai-generated-code1root-cause-analysis1b2b-saas1atlanta-startup1stanford-dawn1telemetry1support-engineering1knowledge-graph1genomics1multi-omics1molecular-diagnostics1hypercoding1raptor-platform1clinical-genomics1biomarker-detection1signal-processing1laboratory-automation1life-sciences1san-diego-biotech1target-detection1policymap1geospatial data1data visualization1location intelligence1gis1mapping platform1demographics1site selection1housing data1community development1philadelphia1public data1neighborhood data1interactive maps1spatial analysis1data licensing1product analytics1open source1feature flags1session replay1a/b testing1experimentation1surveys1data warehouse1web analytics1error tracking1customer data platform1product os1self-hosted analytics1remote-first1open-core1ai product assistant1sql1bioprinting13d-bioprinting1lymph-node-organoid1antibody-discovery1human-antibodies1immune-system1drug-discovery1two-photon-bioprinting1ai-drug-discovery1immunology1organoids1therapeutics1exis-platform1monoclonal-antibodies1audience-data1advertising1demand-generation1account-based-marketing1abm1martech1identity-resolution1data-enrichment1audience-targeting1match-rate-optimization1incrementality-testing1website-de-anonymization1salesforce-sync1meta-audiences1linkedin-targeting16sense1demandbase1growth-marketing1san-francisco1craft-ventures1salesforce-ventures1conversion-tracking1privacy-compliant1email marketing1sms marketing1popups1list growth1cart abandonment1conversion optimization1small business1exit intent1spin to win1segmentation1customer retention1bigcommerce1wix1drag and drop email editor1abandoned cart recovery1circulatory support1aortix1percutaneous pump1cardiorenal syndrome1mechanical circulatory support1cardiology1houston medtech1fda breakthrough device1renal perfusion1blood pump1cardiovascular devices1drain-hf1lupus1autoimmune disease1flare prediction1blood biomarkers1diagnostics1clinical laboratory1patient engagement1lupuscorner1aisle dx1digital biomarkers1systemic lupus erythematosus1oklahoma city1biomarker validation1digital therapeutics1methane monitoring1emissions data1esg1oil and gas1ldar1ghg reporting1responsibly sourced gas1trustwell1canary x1air quality1saas platform1denver1ai-native gtm1go-to-market automation1multiagent operations1workflow orchestration1coordination infrastructure1sales automation1metaverse1web31nft oasis1virtual events1silicon valley1digital cmc1pharmaceutical software1biotech software1quality by design1qbd1product lifecycle management1plm121 cfr part 111iso 134851gamp51knowledge management1tech transfer1life sciences1austin texas1ai-ready1healthcare ai1clinical decision support1health systems1ai governance1llms1health it1hospitals1epic integration1public benefit company1medical software1health informatics1kras inhibitors1ras-driven cancers1allosteric drug discovery1second harmonic generation1shg technology1targeted cancer therapy1g12d inhibitor1g12v inhibitor1pan-kras1small molecule drugs1pancreatic cancer1colorectal cancer1drug discovery platform1protein conformation1phase 1 clinical trials1south san francisco biotech1bayesian optimization1chemicals1materials science1formulation1r&d1experimental design1design of experiments1specialty chemicals1paints and coatings1pharmaceuticals1materials informatics1maritime1maritime-intelligence1maritime-domain-awareness1defense1defense-technology1ocean-surveillance1vessel-tracking1smartmast1distributed-sensor-network1edge-ai1computer-vision1ais1radar1infrared-imaging1satellite-communication1autonomous-vessel-monitoring1national-security1hive-mind1real-time-surveillance1pcb design1automated pcb layout1physics-driven ai1electronics design automation1autonomous routing1circuit board design1hardware1aerospace and defense1physics simulation1design validation1flow battery1long-duration energy storage1organic quinones1redox flow battery1grid energy storage1renewable energy1energy storage1harvard spinout1battery manufacturing1aqueous organic flow battery1vanadium alternative1domestic supply chain1ldes1implantable sensor1blood pressure1hypertension1biosensor1wireless implant1qsmart1qsense1preclinical medtech1intraocular pressure1glaucoma1post-quantum cryptography1pqc1quantum-safe encryption1cybersecurity1crypto-agility1cryptographic agility1quantum security1zero trust1network security1data in transit1harvest now decrypt later1nist standards1critical infrastructure1government security1satellite security1quprotect1crypto inventory1cryptographic bill of materials1enterprise security1quantum readiness1ewa1on-demand pay1financial wellness1payroll1financial health1instant pay1daily pay1financial literacy1employee retention1hourly workers1santa monica1ramani1ramani.io1tanzania1africa1b2b fintech1micro-distribution1cpg supply chain1supply chain finance1working capital1point of sale1pos software1merchant management1dar es salaam1supply chain digitization1b2b ecommerce1embedded finance1fmcg1emerging markets1offline software1low-connectivity1medical robotics1motorized knee orthosis1ai gait biomarker1neurological rehabilitation1stroke recovery1mobility assistance1electro-hydraulic actuation1gait analysis1dreeven1reev sense1rehabilitation technology1paraplegia mobility1patient monitoring1techstars1artificial intelligence1superintelligence1open models1open source ai1autonomous coding1coding agents1large language models1frontier ai1asimov1mixture of experts1ai research1ai safety1post-training1modular construction1microfactory1physical ai1net-zero homes1prefab homes1affordable housing1offsite manufacturing1climate-resilient housing1fire-resistant homes1construction automation1passive house1amazon robotics1somerville massachusetts1housing crisis1rockets1additive manufacturing1reusable rockets1terran r1terran 11aeon engines1stargate 3d printer1space launch1launch services1satellite deployment1low earth orbit1geosynchronous transfer orbit1propulsion1methane rocket1autonomous manufacturing1robotic manufacturing1space economy1nasa stennis1cape canaveral1eric schmidt1tim ellis1data centers in orbit1ai visual inspection1machine vision1quality assurance automation1industry 4.01defect detection1smart manufacturing1no-code ai1shop-floor ai1predictive maintenance1non-destructive testing1relivision1edge and cloud1process control1carbon capture1mobile carbon capture1tailpipe capture1heavy-duty trucks1locomotives1freight rail1co2 removal1carbon removal1climatetech1greentech1adsorbents1zero-backpressure1tier 4 emissions1carbon credits1co2 offtake1detroit1michigan1hardware manufacturing1transportation1yard management1yard execution system1logistics software1dock scheduling1gate automation1driver check-in1freight movement1waire program1isr compliance1scaqmd rule 23051emissions reporting1freight theft prevention1biometric driver validation1contactless operations1detention and demurrage1warehouse management1transportation management1control tower visibility1ebol1epod1milwaukee startup1cloud-based platform1rental platform1ai rental assistant1tenant screening1property management1long-term rentals1digital lease1rent payment automation1modular homes1global rental marketplace1blockchain rental1rental application1ukrainian founders1virtual tours1automated rent collection1rental pricing1pre-ipo1equipment rental software1rental management1heavy equipment1construction tech1ai-powered1online storefront1quickbooks sync1mobile inspections1fleet management1rental operating system1payments and invoicing1chicago startup1plastic neutral1plastic credits1epr compliance1packaging compliance1extended producer responsibility1plastic recovery1ocean-bound plastic1sustainability software1impact verification1plastic footprint1waste worker empowerment1cpg sustainability1plastic offset1advanced recycling1chemical recycling1microwave pyrolysis1cmap technology1plastic to oil1pyoil1plastic waste1modular recycling1decentralized recycling1pyrolysis1low carbon fuel1circular plastics1petrochemical1aging1rejuvenation1autophagy1cellular reprogramming1alzheimers1neurodegeneration1microglia1plasma therapeutics1healthspan1stem cells1regenerative medicine1sam altman1rtr2421silicon valley biotech1single-cell multi-omics1property management software1trust accounting1embedded banking1embedded payments1ap ar automation1maintenance tracking1portfolio management1detroit startup1multifamily1single-family rentals1student housing1gaap accounting1owner distributions1bank reconciliation1resident portals1ruby on rails1ai property management1returns recovery1deadstock1circular fashion1sustainable fashion1inventory recovery1b-corp1reverse logistics1refurbishment1resale1ai inventory1garment recovery1retail technology1waste diversion1supply chain sustainability1asset recovery1ai chip design1semiconductor1alphachip1frontier ai lab1custom silicon1tpu1chip design automation1designless1ai hardware co-design1online education1online program management1opm1higher education1university partnerships1regional universities1workforce-focused degrees1adult learners1student support1enrollment management1marketing services1online nursing programs1student roi1academic partnerships1wiley university services1waste management1recycling1zero waste1waste metering1esg reporting1landfill diversion1commercial recycling1facility services1pittsburgh startup1cardboard recycling1waste analytics1smart waste1knee brace1osteoarthritis1mobility1pneumatic actuators1military exoskeleton1human augmentation1rehabilitation1dual-use technology1pain reduction1education technology1stem education1coding for kids1robotics kit1gamified learning1c++ programming1e-learning1consumer electronics1silicon valley startup1ai education1origin kit1castle rock platform1rogo1rogo ai1financial ai1investment banking ai1felix1private equity1hedge funds1financial modeling1due diligence1deal sourcing1secure ai1wall street1llms for finance1financial research automation1mezcal1agave-spirits1oaxaca1single-estate1organic-spirits1sustainable-spirits1beverage-manufacturing1tequila-alternative1craft-spirits1carbon-neutral1distintivo-verde1santiago-matatlan1espadin1premium-spirits1ear piercing1nurse-led piercing1hypoallergenic jewelry1medical-grade jewelry1safe piercing1pediatric ear piercing1ear stacking1retail studios1jewelry1consumer brand1licensed nurses1needle piercing1ear care1rowspace1financial intelligence1institutional knowledge1private equity ai1portfolio monitoring1credit analysis1proprietary data1decision intelligence1sequoia1emergence capital1michael manapat1yibo ling1music royalties1royalty processing1music publishing administration1mechanical licensing1royalty accounting1music rights management1catalog registration1white-label royalties1music industry1royalty audit1music licensing1music business management1music finance1military logistics1predictive logistics1edge ai1contested logistics1tyros1offline-first1mesh networking1sustainment1govtech1anduril alumni1series a1arlington virginia1smart building1building automation1heating controls1boiler management1wireless sensors1hvac1local law 971local law 841local law 871energy management1demand response1new york city1mushroom coffee1superfoods1medicinal mushrooms1coffee alternative1organic1gluten-free1no jitters1boston startup1consumer health1earthquake risk management1catastrophe risk1structural health monitoring1building sensors1parametric insurance1seismic risk analytics1disaster response1real-time damage assessment1reinsurance1business continuity1san francisco1cruisebound1cruise booking1online travel agency1travel tech1startup founder1ceo1mit1polytechnique montreal1series b1thayer ventures1booking holdings1travel startup1leisure1tourism1mobile-first1canada1industrial engineering1antibody engineering1antibody-drug conjugates1bispecific antibodies1cardiovascular1nrg-11erbb415t41biparatopic adc1protein therapeutics1gaithersburg maryland1biologics1first-in-class1prior authorization1specialty medications1medical benefit1biologics access1patient access1emr integration1pharma market access1benefit verification1rheumatology1retina1neurology1neurotechnology1womens-health1pmdd1menstrual-pain1wearable1tdcs1brain-stimulation1neurostimulation1drug-free1hormone-free1non-invasive1nettle1medical-device1neuroplasticity1menstrual-health1pms1digital-health1health insurtech1small business health insurance1employer sponsored health insurance1group medical plans1level-funded plans1virtual primary care1benefits administration1healthcare cost reduction1austin startup1sana care1headless cms1content operating system1structured content1content lake1groq1portable text1sanity studio1api-first1composable content1ai content1omnichannel1real-time collaboration1content infrastructure1digital experience platform1content management1visual editing1enterprise content1lingerie1intimates1loungewear1size inclusivity1body positivity1inclusive fashion1rihanna1fenty1bras1underwear1mens essentials1bridal lingerie1xtra vip1personalization1ai sizing1fit match1diverse models1apparel1fashion show1amazon prime video1facebook ads1instagram ads1google ads1tiktok ads1meta ads1ad automation1ad optimization1lookalike audiences1retargeting1audience targeting1shopify app1ecommerce ads1dropshipping1roas optimization1ai ad copy1ad creative generation1campaign analytics1ad scaling1media buying1digital marketing software1silicon photonics1integrated photonics1integrated lasers1optical interconnects1dwdm1co-packaged optics1ai data centers1photonic integrated circuits1iii-v on silicon1ship technology1leaf light1optical transceivers1fabless1grenoble1predictive analytics1decision sciences1data engineering1scorefast1customer engagement1fraud detection1contact center ai1financial services1insurance1model management1etl services1ai/ml platform1risk assessment1churn management1call routing1pace program1senior care1geriatric care1culturally tailored care1asian and pacific islander elders1aging in place1medicare medicaid1family caregivers1home health1community-based care1elder care startup1alhambra california1san gabriel valley1oncolytic virus1seneca valley virus1svv-0011cancer immunotherapy1tem81antxr11neuroendocrine cancer1checkpoint inhibitors1viral vector1clinical-stage biopharma1biomarker1armed viruses1philadelphia biotech1mental health1cns therapeutics1ai drug discovery1anxiety treatment1serotonin modulator1ethnopharmacology1natural products1sensai platform1boston biotech1psychoactive medicines1metal additive manufacturing1area printing1metal 3d printing1contract manufacturing1laser powder bed fusion1reshoring1supply chain resilience1high-volume metal production1sustainable manufacturing1digital manufacturing1automotive1wilmington massachusetts1lawrence livermore1nvidia nventures1series c1
Often tagged with
Showing 22 results for seed-investor
Sort:
LEGEND!
Raphael Schaad
RS
PersonFounderDesigner
Raphael Schaad

Raphael Schaad is a Swiss designer-engineer and Visiting Partner at Y Combinator who built three generation-defining products: iA Writer (the minimalist writing app), Flipboard (the original social magazine), and Cron (acquired by Notion in 2022). Raised in the Swiss Alps, trained at MIT Media Lab, he brings a rare combination of technical depth and design taste that has made him a go-to mentor for founders navigating the AI era.

designerengineerfoundery-combinatorcronnotion
LEGEND!
Lucian Todea
LT
PersonFounderInvestor
Lucian Todea

Lucian Todea is a Romanian-born serial entrepreneur and early-stage investor who built Soft32 from a $3/month passion project into one of the world's largest software distribution platforms, co-founded MultiversX (formerly Elrond) - a pioneering layer-1 blockchain - and now serves as Partner at 2048 Ventures in New York, where he has invested in 200+ companies including Anthropic, Perplexity, Chainalysis, Suno, and Kraken. An Ironman finisher and relentless builder, Todea embodies the conviction that technology exists not for its own sake, but to improve and enrich human lives.

venture-capitalearly-stage-investorblockchainmultiversxelrond2048-ventures
LEGEND!
Rachel Lyubovitzky
RL
PersonFounderInvestor
Rachel Lyubovitzky

Rachel Lyubovitzky is a serial entrepreneur who has founded four B2B technology companies and exited three of them, generating approximately $12 billion in combined exits with her co-founders. She is the CEO, co-founder, and Chairwoman of Setuply, an AI-powered client onboarding and lifecycle management platform, and a Partner at 2048 Ventures, a pre-seed and seed stage VC firm. With a Wharton Executive MBA and a computer science background from Brandeis University, she bridges deep technical fluency with executive leadership - having built and sold companies in HR tech, benefits automation, and search. She is also a Forbes Technology Council member, a published author, and has visited more than 60 countries.

serial-entrepreneurb2b-saasaienterpriseventure-capitalhr-tech
LEGEND!
Asheem Chandna
AC
PersonInvestorAdvisor
Asheem Chandna

Asheem Chandna is a General Partner at Greylock Partners, one of Silicon Valley's most storied venture firms, where he has spent over two decades backing category-defining companies in cybersecurity, enterprise software, and AI. Since joining Greylock in 2003, he has never lost capital on a single investment he led - a streak spanning Palo Alto Networks, AppDynamics (acquired by Cisco for $3.85B), Rubrik (IPO 2024), Abnormal Security, and Wiz. A Mumbai-raised engineer who cut his teeth at Bell Labs and scaled marketing at Check Point Software from $10M to $550M in revenue, Chandna brings an operator's instinct to early-stage bets, often writing checks before a deck exists. Named to the Forbes Midas List nine times, he is among the most respected cybersecurity investors in the world.

venture-capitalcybersecurityenterprise-softwaregreylocksilicon-valleyai
LEGEND!
Jenny Lefcourt
JL
PersonInvestorFounder
Jenny Lefcourt

Jenny Lefcourt is a General Partner at Freestyle VC, a San Francisco-based seed-stage venture capital firm with $565M+ AUM. A serial entrepreneur who dropped out of Stanford GSB to co-found WeddingChannel.com (backed by Kleiner Perkins), she later co-founded Bella Pictures before transitioning to venture capital in 2014. She has since backed iconic companies including Airtable, Patreon, BetterUp, and Intercom, earned spots on the Forbes Midas Seed List and Forbes 50 Over 50, and co-founded All Raise, the nonprofit accelerating female founders and funders in tech.

venture-capitalseed-investorfreestyle-vcweddingchannelbella-picturesall-raise
LEGEND!
Niko Bonatsos
NB
PersonInvestorFounder
Niko Bonatsos

Niko Bonatsos is a Greek-born, Stanford-educated venture capitalist who spent 15 years at General Catalyst building one of Silicon Valley's strongest seed-stage consumer investment track records - backing Snap, Discord, Mercor, ClassDojo, and Dubsmash before most people knew they existed. In January 2026 he left General Catalyst to co-found Verdict Capital with Michael Fertik, targeting a $300M fund focused on seed/Series A investing in consumer and AI, with a particular contrarian bet on consumer AI being underappreciated in an enterprise-saturated market.

venture-capitalseed-investorconsumeraigeneral-catalystverdict-capital
LEGEND!
Pejman Nozad
PN
PersonInvestorFounder
Pejman Nozad

Pejman Nozad is the Founding Managing Partner of Pear VC, a $800M+ AUM seed-stage venture firm he co-founded in 2013. Born in Tehran, he arrived in Silicon Valley in 1992 with $700 and no English, worked as a car washer, lived in a yogurt shop attic, then became the top Persian rug salesman on University Avenue in Palo Alto — selling $8M in a single year to the Valley's most powerful VCs and founders. Those relationships became deal flow. He backed Dropbox, DoorDash ($1.9M seed → $440M), AppLovin, and Andy Rubin's pre-Android company Danger. Forbes ranked him #1 on its Midas Seed List three consecutive years (2023, 2024, 2025). He has no CS degree, no MBA, and never worked in tech — yet built one of the highest-performing seed funds ever and joined the board of Sheffield United FC in 2025.

venture-capitalseed-investorpear-vcsilicon-valleyiranian-americanimmigrant-founder
LEGEND!
Eric Paley
EP
PersonFounderInvestor
Eric Paley

Eric Paley is a serial entrepreneur turned seed-stage venture capitalist who co-founded Founder Collective in 2008, building it into one of the world's highest-performing seed funds with investments in Uber, The Trade Desk, Airtable, and 20+ unicorns. Before VC, he co-founded Brontes Technologies — a 3D dental imaging startup spun out of MIT — and sold it to 3M for $95 million in 2006. A perennial Forbes Midas List honoree (ranked as high as #9 globally and the world's top-ranked seed investor), he became known for his unusually candid critiques of venture capital excess. In June 2025, he left Founder Collective to serve as Massachusetts Secretary of Economic Development under Governor Maura Healey, overseeing a 700-person agency focused on housing affordability, business competitiveness, and the AI innovation economy.

venture-capitalseed-investorfounder-collectivestartupbostonmassachusetts
LEGEND!
Gigi Levy-Weiss
GL
PersonInvestorFounder
Gigi Levy-Weiss

Gigi Levy-Weiss is a General Partner and co-founder at NFX, a San Francisco-based pre-seed and seed venture capital firm managing $875M+ across 577+ portfolio companies with 25 unicorns. A former Israeli Air Force attack helicopter pilot turned serial entrepreneur, he co-founded Playtika (sold to Caesars for ~$180M; later valued at $4.4B), served as CEO of 888 Holdings (a London-listed online gaming company), and made 150+ angel investments before co-founding NFX in 2015. Known for combining military-grade rigor with a warm, self-deprecating sense of humor, he leads NFX's Israel office and focuses on gaming, bio, space, and generative AI.

venture-capitalnfxnetwork-effectsisraelgamingplaytika
LEGEND!
Gili Raanan
GR
PersonInvestorFounder
Gili Raanan

Gili Raanan is an Israeli cybersecurity pioneer turned venture capitalist who invented CAPTCHA, co-created the world's first Web Application Firewall, and then built Cyberstarts — a seed-only VC that turned $54M into over $1B and backed Wiz, the $32B cloud-security juggernaut acquired by Google in 2025. A decade in IDF Unit 8200, two successful exits, nine years as a Sequoia Capital Israel GP, and $1.4B+ in capital raised makes him arguably the most influential figure in the Israeli cyber startup ecosystem.

cybersecurityventure-capitalisraelunit-8200cyberstartsseed-investor
LEGEND!
Nina Achadjian
NA
PersonInvestorFounder
Nina Achadjian

Nina Achadjian is a Partner at Index Ventures, one of the world's leading VC firms, where she invests at seed, venture, and growth stages with a focus on AI, robotics, software for hardware, and vertical SaaS. A Harvard-educated former bond trader and Google AdSense leader, she founded HIVE Ventures — the first seed fund for Armenian entrepreneurs — before joining Index. Her portfolio includes Anthropic, ServiceTitan (IPO 2024), Gong, Physical Intelligence, and 20+ other companies. Known for backing category-defining vertical software companies years before they become mainstream, she sits on 24+ company boards.

venture-capitalindex-venturesaivertical-saasroboticssoftware-for-hardware
LEGEND!
Pete Flint
PF
PersonFounderInvestor
Pete Flint

Pete Flint is a British-born serial entrepreneur and venture capitalist who co-founded Trulia, the real estate search platform that sold to Zillow for $3.5 billion in 2015. Before that, he was part of the founding team at lastminute.com, which IPO'd in London and sold for $1.1 billion. He is now General Partner at NFX, a seed-stage VC firm built around the thesis that network effects drive 70% of all technology value creation. He was awarded an OBE in 2021 for services to entrepreneurship.

proptechventure-capitalnetwork-effectstrulianfxreal-estate
LEGEND!
Saar Gur
SG
PersonInvestorFounder
Saar Gur

Saar Gur is a General Partner at CRV (Charles River Ventures), one of Silicon Valley's oldest venture firms, where he has backed some of the most iconic consumer and SMB software companies of the past decade. Before turning investor, he co-founded BrightRoll, the video ad network that Yahoo acquired for $640 million. Known for betting early on 'weird' ideas before the world caught up, his portfolio includes DoorDash (seed in 2013), Patreon, Ring, Dropbox, Airtable, Mercury, and Niantic. He has ranked on the Forbes Midas List (#22 in 2023), taught at Stanford's StartupGarage, and summits mountains with founders for fun.

venture-capitalcrvcharles-river-venturesseed-investorconsumerdoordash
LEGEND!
Katie Jacobs Stanton
KJ
PersonInvestorExecutive
Katie Jacobs Stanton

Katie Jacobs Stanton is the Founder and General Partner of Moxxie Ventures, a San Francisco-based seed-stage venture firm managing $95M+ across three funds. A former VP of Global Media at Twitter, Director of Citizen Participation at the Obama White House, and State Department innovation advisor, she built her reputation deploying technology at the intersection of government, media, and social change - including spearheading the Haiti earthquake text-donation platform that raised $40M in days. Co-founder of #Angels, a collective that has placed capital in 120+ companies, she now backs outlier founders across enterprise software, climate tech, and vertical AI.

venture-capitalmoxxie-venturestwittergoogleobama-white-housestate-department
LEGEND!
Kevin Hartz
KH
PersonFounderInvestor
Kevin Hartz

Kevin Hartz is a Silicon Valley serial founder and venture investor who co-founded Eventbrite (NYSE: EB) and Xoom (acquired by PayPal for $1.1B), made seed-stage bets on PayPal, Airbnb, Uber, Pinterest, Palantir, Square, Stripe, and Slack, and now runs A* Capital — a $300M early-stage fund that bets heavily on teenage founders. His career spans 30+ years of building and backing transformative tech companies from Berkeley to the world stage.

eventbritexoompaypalairbnbubersilicon-valley
LEGEND!
Austin Rief
AR
PersonFounderOperator
Austin Rief

Austin Rief co-founded Morning Brew in 2015 as a college sophomore after cold-emailing a classmate about a PDF newsletter. He helped grow it from a campus PDF to a 5-million-subscriber media company with $70M+ revenue before Axel Springer bought it outright. He served as CEO from 2021 to 2025, then stepped back to Executive Chairman while building Oceans Talent (an offshore staffing platform at $15M ARR) and Rief Ventures, a seed fund with 16+ investments including enterprise AI unicorn WRITER.

morning-brewnewslettermediaentrepreneurfounderceo
LEGEND!
Sheel Mohnot
SM
PersonInvestorFounder
Sheel Mohnot

Sheel Mohnot is a San Francisco-based fintech investor and co-founder of Better Tomorrow Ventures (BTV), a $300M+ seed-stage fund backing fintech companies globally. A two-time fintech founder himself - having built and exited FeeFighters (acquired by Groupon, 2012) and Innovative Auctions - Sheel brings rare operator credibility to early-stage investing. He co-founded The Pitch podcast, co-leads BTV's The Mint accelerator, and is one of fintech's most-followed voices on Twitter/X with 150K+ followers. Known for his fintech-only thesis, global portfolio (33% outside US), and a Taco Bell metaverse wedding officiated by Kal Penn.

fintechventure-capitalbetter-tomorrow-venturesseed-investorpaymentsembedded-finance
LEGEND!
Phin Barnes
PB
PersonInvestorFounder
Phin Barnes

Phin Barnes is a co-founder and Managing Partner of The General Partnership (TheGP), a $300M seed-stage VC firm built on a 'sweat equity' model that pairs capital with embedded operational talent. Before TheGP, he spent 13 years at First Round Capital rising from unpaid intern to General Partner, co-created the Dorm Room Fund, and backed companies like Notion. His pre-VC career included scaling AND1 sneakers from $15M to $225M and founding one of the first fitness video games for Xbox and PlayStation 2 - making him one of the few investors who can say they've run a shoe brand, shipped a console game, and written the check.

venture-capitalseed-investorsneakerheadfirst-round-capitalthe-general-partnershipthegp
LEGEND!
Ullas Naik
UN
PersonInvestorFounder
Ullas Naik

Ullas Naik is the Founder and General Partner of Streamlined Ventures, a Palo Alto-based seed fund with $325M+ AUM across 8 funds and 200+ portfolio companies. A Mumbai-born immigrant who cold-called his way onto Wall Street 40 days straight, he went on to back AppLovin and DoorDash at seed stage before either company had a name anyone recognized - a combined market cap now exceeding $170B. With 21 unicorns and 3 decacorns in his portfolio, he operates as a solo GP with a reputation for being a 'founder whisperer' who brings candor, empathy, and conviction to early-stage investing.

venture-capitalseed-investorstreamlined-venturessilicon-valleyapplovindoordash
LEGEND!
Julian Shapiro
JS
PersonFounderInvestor
Julian Shapiro

Julian Shapiro is a Canadian-born entrepreneur, deeptech seed investor, and prolific writer who built a career that spans open-source animation engines, growth marketing agencies, and a Y Combinator-backed startup. He founded Demand Curve, the largest growth marketing education platform for startups, and now runs Julian.capital, a deeptech seed fund writing $500K-$2M checks into robotics, chips, energy, medtech, and biotech. His free handbooks at julian.com - covering writing, startups, fitness, and audio - are read by over a million people annually. He co-hosts the Brains Podcast with Courtland Allen and was previously VP of Marketing at Webflow.

growth-marketingstartupwritingventure-capitaldeeptechdemand-curve
LEGEND!
Nihal Mehta
NM
PersonInvestorFounder
Nihal Mehta

Nihal Mehta is a serial entrepreneur turned seed-stage venture capitalist and Co-Founder & General Partner at ENIAC Ventures, one of New York's leading seed funds. Known as the 'Human Rolodex,' Mehta has backed early investments in Uber, Airbnb, AdMob (acquired by Google), and SwiftKey (acquired by Microsoft) while building a reputation as a founder-first investor who connects people without keeping score. He founded Pitch & Run NYC, a community blending startup pitches with morning runs, and hosts the Human Unicorn Podcast. A UPenn dual-degree graduate who once filed for Chapter 7 bankruptcy in his 20s, Mehta channels that hard-won empathy into backing the next generation of founders through ENIAC's $160M sixth fund.

venture-capitalseed-investoreniac-venturesnew-yorkstartupsmobile
LEGEND!
Nikhil Basu Trivedi
NB
PersonInvestorFounder
Nikhil Basu Trivedi

Nikhil Basu Trivedi is a Co-Founder and General Partner at Footwork Ventures, a San Francisco-based early-stage VC firm with $400M+ under management across two funds. A Princeton molecular biology graduate turned venture capitalist, he previously spent eight years at Shasta Ventures where he backed Canva, ClassDojo, Frame.io, and The Farmer's Dog. He writes the 'Next Big Thing' newsletter on Substack with 18,000+ subscribers, publishes public investment theses before backing founders, and built his career on a 'traction-first' philosophy and obsessive focus on founder learning velocity. An Indian-American from a family with deep public service roots, he co-founded Artsy as a Princeton sophomore and has been a Forbes 30 Under 30 honoree.

venture-capitalconsumer-technewsletterfootwork-venturesnext-big-thingseed-investor