Pricing
TAGS

Tagged Content

Tagged: community

Everything on the platform tagged with community.

Browse all tags
b2b saas14digital health11saas11b2b11machine learning9fintech8d2c8telehealth7ai7climate tech7wellness6biotechnology6proptech6remote patient monitoring5agentic ai5sustainability5decarbonization5medical devices5enterprise ai5value-based care4biotech4food and beverage4ecommerce4healthtech4real estate technology4reinforcement learning4clinical trials4developer tools4oncology4circular economy4hr tech3developer-tools3ai agents3new york startup3chronic disease management3financial inclusion3y combinator3san francisco startup3computer vision3energy3supply chain3robotics3defense tech3usage-based pricing2virtual care2femtech2endometriosis2clinical-stage2neuroscience2cell therapy2immuno-oncology2solid tumors2immunotherapy2holistic health2gut health2primary care2mobile app2dtc2direct-to-consumer2shopify2social determinants of health2care navigation2population health2lead generation2energy efficiency2deepmind alumni2precision medicine2longevity23d printing2b2b software2london startup2earned wage access2api integration2workflow automation2workday2carbon accounting2functional mushrooms2adaptogens2plant-based2lions mane2cordyceps2reishi2immune support2proteomics2data analytics2marketing automation2heart failure2multiple sclerosis2healthcare technology2continuous monitoring2leak detection2regulatory compliance2iot sensors2manufacturing2generative ai2ai infrastructure2clinical-stage biotech2precision oncology2deep tech2eda2semiconductors2clean energy2healthcare analytics2cybersecurity2employee benefits2inventory management2wearable robotics2exoskeleton2assistive technology2aerospace2deep learning2predictive maintenance2ai logistics2cleantech2gene therapy2fashion tech2palo alto startup2edtech2carbon reduction2ai for finance2vegan2new york2demand response2e-commerce2subscription2insurtech2drug discovery2ai healthcare2upskilling1reskilling1learning and development1corporate training platform1skills management software1ai in hr1talent development1employee development platform1learning marketplace1skills gap analysis1hris integration1workforce upskilling1skills-first1professional development1microlearning1learning analytics1internal mobility1bitcoin1lightning-network1bitcoin-payments1payment-processor1crypto-payments1payouts1payment-gateway1bitcoin-api1hosted-checkout1in-person-payments1currency-conversion1settlement1ecommerce-plugins1merchant-payments1instant-settlement1pelvic health1pelvic floor physical therapy1womens health1physical therapy1postpartum care1menopause1insurance covered pt1painful sex1pelvic organ prolapse1bladder control1diastasis recti1trauma-informed care1evidence-based care1healthcare1cell-therapy1parkinsons-disease1neuron-replacement1ipsc1dopaminergic-neurons1neurodegenerative1autologous1regenerative-medicine1stem-cells1virtual gi care1digestive health1gastroenterology1ibs1ibd1crohns disease1ulcerative colitis1gerd1multidisciplinary care1gut-brain1behavioral health integration1registered dietitian1virtual specialty care1center of excellence1health plan partnerships1whole-person care1osmo1digital olfaction1ai scent1olfactory intelligence1scent teleportation1fragrance ai1principal odor map1smell digitization1molecular discovery1graph neural networks1aroma molecules1alex wiltschko1google brain spinout1generation by osmo1scent design1ostium1perpetuals1perps1rwa1real-world-assets1defi1decentralized-exchange1dex1arbitrum1onchain-trading1commodities1forex1stocks1indices1synthetic-assets1leverage1crypto1self-custody1tradfi1protein design1ai protein design1car t cells1synthetic biology1de novo proteins1cytokines1cancer treatment1seattle biotech1programmable proteins1music production software1virtual instruments1audio plugins1sound design1ai music1arcade1co-producer1sample library1vst plugins1music technology1daw1royalty-free samples1music creation1los angeles startup1summit partners1ai cybersecurity1brand protection1digital threat detection1impersonation removal1phishing detection1deepfake detection1threat intelligence1automated threat response1scam takedown1executive protection1soar integration1siem integration1open-source intelligence1digital trust1boozy tea1hard tea1canned cocktails1spiked pop1hard soda1tea cocktails1real ingredients1low sugar alcohol1low calorie1women-led1tea sommelier1botanicals1ready-to-drink1craft beverage1responsible drinking1legal software1legal tech1ediscovery1social media evidence1web capture1digital evidence1chain of custody1court admissibility1website archiving1metadata and hashing1affidavit generation1litigation support1evidence preservation1remote browsing1legal services1pizza1restaurants1new england1thin-crust pizza1quick service1massachusetts1pizzeria1italian food1dedham1regional chain1family restaurant1postgres1search1full-text-search1bm251analytics1olap1elasticsearch-alternative1open-source1database1tantivy1rust1pg_search1acid1opensearch1functional medicine1telemedicine1root-cause medicine1autoimmune care1hormonal health1metabolic health1preventive medicine1lab testing1biomarker testing1health coaching1nutrition1membership healthcare1women's health1lifestyle medicine1event planning1online invitations1rsvp tracking1party planning1guest management1evite alternative1gen z1consumer social1ticketing1birthday invites1text message invites1event management1social events1andreessen horowitz1healthcare financing1patient financing1point-of-sale financing1medical aesthetics1elective procedures1buy now pay later1bnpl healthcare1plastic surgery financing1dental financing1fertility financing1lasik financing1soft credit check1practice management1monthly payment plans1patient affordability1pattern-brands1home-goods1consumer-brands1brand-aggregator1brand-acquisition1kitchen-tools1home-organization1home-decor1gin-lane1new-york1multi-brand-platform1consumer-products1brand-building1community health workers1chw1sdoh1care management1medicaid billing1health plans1promotores1doulas1case management1ai workflows1claims management1community-based organizations1referral management1b2b data1data enrichment1people data1company data1data as a service1daas1developer apis1person enrichment1company enrichment1data provider1sales intelligence1identity resolution1data science1professional profiles1ip enrichment1job posting data1big data1api1relocation1global mobility1ai home search1employee relocation1immigration1visa support1destination services1relocation management1expense management1mobility platform1corporate relocation1international relocation1mls platform1residential real estate1data and workflow platform1market analytics1agent productivity1listing management1client collaboration1reso certified api1real estate data1new york city real estate1ai property descriptions1diabetes management1type 2 diabetes1connected glucose meter1blood glucose monitoring1medicare1doctor-led care1senior health1at-home diabetes care1personalized coaching1asset-backed credit card1secured credit card1pawn alternative1credit building1underbanked1mastercard1consumer lending1collateral lending1industrial ai1data center cooling1ai control systems1autonomous control1virtual plant operator1ai factories1mission critical facilities1closed-loop control1pue reduction1self-learning ai1liquid cooling1chiller plant optimization1body composition1mri1medical imaging1radiomics1phenotyping1quantified self1whole-body imaging1digital physical exam1accessible imaging1physna1thangs13d search1geometric search1geometric deep learning13d model search engine1object dna1cad1intellectual property protection1manufacturing software1enterprise saas1columbus ohio1adtech1digital advertising1social display1user-first advertising1mobile advertising1sustainable advertising1carbon neutral ads1publisher monetization1programmatic1ad formats1attention metrics1open web1creative optimization1inventory quality1pinwheel1payroll api1income verification1direct deposit switch1deposit switching1account activation1switch kit1primacy1bill switching1payroll data connectivity1real-time income data1fcra compliance1consumer reporting agency1banking technology1open banking1credit unions1neobanks1pipedream1serverless1mcp servers1model context protocol1no-code automation1low-code1integration platform1ipaas1connect sdk1lifecycle assessment1ghg inventory1scope 3 emissions1net zero1climate software1consumer products1cpg1carbon labels1science based targets1supplements1mushroom gummies1vegan supplements1nootropics1b corporation1climate neutral1herbal supplements1clean label1brain health1sleep support1austin1texas1gummy vitamins1agentic-ai1code-simulation1software-quality1predictive-software-quality1ai-debugging1enterprise-software1codesim1sim-11engineering-productivity1bug-prevention1ai-generated-code1root-cause-analysis1b2b-saas1atlanta-startup1stanford-dawn1telemetry1support-engineering1knowledge-graph1genomics1multi-omics1molecular-diagnostics1hypercoding1raptor-platform1clinical-genomics1biomarker-detection1signal-processing1laboratory-automation1life-sciences1san-diego-biotech1target-detection1policymap1geospatial data1data visualization1location intelligence1gis1mapping platform1demographics1site selection1housing data1community development1philadelphia1public data1neighborhood data1interactive maps1spatial analysis1data licensing1product analytics1open source1feature flags1session replay1a/b testing1experimentation1surveys1data warehouse1web analytics1error tracking1customer data platform1product os1self-hosted analytics1remote-first1open-core1ai product assistant1sql1bioprinting13d-bioprinting1lymph-node-organoid1antibody-discovery1human-antibodies1immune-system1drug-discovery1two-photon-bioprinting1ai-drug-discovery1immunology1organoids1therapeutics1exis-platform1monoclonal-antibodies1audience-data1advertising1demand-generation1account-based-marketing1abm1martech1identity-resolution1data-enrichment1audience-targeting1match-rate-optimization1incrementality-testing1website-de-anonymization1salesforce-sync1meta-audiences1linkedin-targeting16sense1demandbase1growth-marketing1san-francisco1craft-ventures1salesforce-ventures1conversion-tracking1privacy-compliant1email marketing1sms marketing1popups1list growth1cart abandonment1conversion optimization1small business1exit intent1spin to win1segmentation1customer retention1bigcommerce1wix1drag and drop email editor1abandoned cart recovery1circulatory support1aortix1percutaneous pump1cardiorenal syndrome1mechanical circulatory support1cardiology1houston medtech1fda breakthrough device1renal perfusion1blood pump1cardiovascular devices1drain-hf1lupus1autoimmune disease1flare prediction1blood biomarkers1diagnostics1clinical laboratory1patient engagement1lupuscorner1aisle dx1digital biomarkers1systemic lupus erythematosus1oklahoma city1personalized medicine1biomarker validation1digital therapeutics1methane monitoring1emissions data1esg1oil and gas1ldar1ghg reporting1responsibly sourced gas1trustwell1canary x1air quality1saas platform1denver1ai-native gtm1go-to-market automation1multiagent operations1workflow orchestration1coordination infrastructure1sales automation1metaverse1web31nft oasis1virtual events1silicon valley1digital cmc1pharmaceutical software1biotech software1quality by design1qbd1product lifecycle management1plm1drug development121 cfr part 111iso 134851gamp51knowledge management1tech transfer1life sciences1austin texas1ai-ready1healthcare ai1clinical decision support1health systems1ai governance1llms1health it1hospitals1epic integration1public benefit company1medical software1health informatics1kras inhibitors1ras-driven cancers1allosteric drug discovery1second harmonic generation1shg technology1targeted cancer therapy1g12d inhibitor1g12v inhibitor1pan-kras1small molecule drugs1pancreatic cancer1colorectal cancer1drug discovery platform1protein conformation1phase 1 clinical trials1south san francisco biotech1bayesian optimization1chemicals1materials science1formulation1r&d1experimental design1design of experiments1specialty chemicals1paints and coatings1pharmaceuticals1materials informatics1maritime1maritime-intelligence1maritime-domain-awareness1defense1defense-technology1ocean-surveillance1vessel-tracking1smartmast1distributed-sensor-network1edge-ai1computer-vision1ais1radar1infrared-imaging1satellite-communication1autonomous-vessel-monitoring1national-security1hive-mind1real-time-surveillance1pcb design1automated pcb layout1physics-driven ai1electronics design automation1autonomous routing1circuit board design1hardware1aerospace and defense1physics simulation1design validation1flow battery1long-duration energy storage1organic quinones1redox flow battery1grid energy storage1renewable energy1energy storage1harvard spinout1battery manufacturing1aqueous organic flow battery1vanadium alternative1domestic supply chain1ldes1implantable sensor1blood pressure1hypertension1biosensor1wireless implant1qsmart1qsense1preclinical medtech1intraocular pressure1glaucoma1post-quantum cryptography1pqc1quantum-safe encryption1crypto-agility1cryptographic agility1quantum security1zero trust1network security1data in transit1harvest now decrypt later1nist standards1critical infrastructure1government security1satellite security1quprotect1crypto inventory1cryptographic bill of materials1enterprise security1quantum readiness1ewa1on-demand pay1financial wellness1payroll1financial health1instant pay1daily pay1financial literacy1employee retention1hourly workers1santa monica1ramani1ramani.io1tanzania1africa1b2b fintech1micro-distribution1cpg supply chain1supply chain finance1working capital1point of sale1pos software1merchant management1dar es salaam1supply chain digitization1b2b ecommerce1embedded finance1fmcg1emerging markets1offline software1low-connectivity1medical robotics1motorized knee orthosis1ai gait biomarker1neurological rehabilitation1stroke recovery1mobility assistance1electro-hydraulic actuation1gait analysis1dreeven1reev sense1rehabilitation technology1paraplegia mobility1patient monitoring1techstars1artificial intelligence1superintelligence1open models1open source ai1autonomous coding1coding agents1large language models1frontier ai1asimov1mixture of experts1ai research1ai safety1post-training1modular construction1microfactory1physical ai1net-zero homes1prefab homes1affordable housing1offsite manufacturing1climate-resilient housing1fire-resistant homes1construction automation1passive house1amazon robotics1somerville massachusetts1housing crisis1rockets1additive manufacturing1reusable rockets1terran r1terran 11aeon engines1stargate 3d printer1space launch1launch services1satellite deployment1low earth orbit1geosynchronous transfer orbit1propulsion1methane rocket1autonomous manufacturing1robotic manufacturing1space economy1nasa stennis1cape canaveral1eric schmidt1tim ellis1data centers in orbit1ai visual inspection1machine vision1quality assurance automation1industry 4.01defect detection1smart manufacturing1no-code ai1shop-floor ai1non-destructive testing1relivision1enterprise software1edge and cloud1process control1carbon capture1mobile carbon capture1tailpipe capture1heavy-duty trucks1locomotives1freight rail1co2 removal1carbon removal1climatetech1greentech1adsorbents1zero-backpressure1tier 4 emissions1carbon credits1co2 offtake1detroit1michigan1hardware manufacturing1transportation1yard management1yard execution system1logistics software1dock scheduling1gate automation1driver check-in1freight movement1waire program1isr compliance1scaqmd rule 23051emissions reporting1freight theft prevention1biometric driver validation1contactless operations1detention and demurrage1warehouse management1transportation management1control tower visibility1ebol1epod1milwaukee startup1cloud-based platform1rental platform1ai rental assistant1tenant screening1property management1long-term rentals1digital lease1rent payment automation1modular homes1global rental marketplace1blockchain rental1rental application1ukrainian founders1virtual tours1automated rent collection1rental pricing1pre-ipo1equipment rental software1rental management1heavy equipment1construction tech1ai-powered1online storefront1quickbooks sync1mobile inspections1fleet management1rental operating system1payments and invoicing1chicago startup1plastic neutral1plastic credits1epr compliance1packaging compliance1extended producer responsibility1plastic recovery1ocean-bound plastic1sustainability software1impact verification1plastic footprint1waste worker empowerment1cpg sustainability1plastic offset1advanced recycling1chemical recycling1microwave pyrolysis1cmap technology1plastic to oil1pyoil1plastic waste1modular recycling1decentralized recycling1pyrolysis1low carbon fuel1circular plastics1petrochemical1aging1rejuvenation1autophagy1cellular reprogramming1alzheimers1neurodegeneration1microglia1plasma therapeutics1healthspan1stem cells1regenerative medicine1sam altman1rtr2421silicon valley biotech1single-cell multi-omics1property management software1trust accounting1embedded banking1embedded payments1ap ar automation1maintenance tracking1portfolio management1detroit startup1multifamily1single-family rentals1student housing1gaap accounting1owner distributions1bank reconciliation1resident portals1ruby on rails1ai property management1returns recovery1deadstock1circular fashion1sustainable fashion1inventory recovery1b-corp1reverse logistics1refurbishment1resale1ai inventory1garment recovery1retail technology1waste diversion1supply chain sustainability1asset recovery1ai chip design1semiconductor1alphachip1frontier ai lab1custom silicon1tpu1chip design automation1designless1ai hardware co-design1online education1online program management1opm1higher education1university partnerships1regional universities1workforce-focused degrees1adult learners1student support1enrollment management1marketing services1online nursing programs1student roi1academic partnerships1wiley university services1waste management1recycling1zero waste1waste metering1esg reporting1landfill diversion1commercial recycling1facility services1pittsburgh startup1cardboard recycling1waste analytics1smart waste1knee brace1osteoarthritis1mobility1pneumatic actuators1military exoskeleton1human augmentation1rehabilitation1dual-use technology1pain reduction1education technology1stem education1coding for kids1robotics kit1gamified learning1c++ programming1e-learning1consumer electronics1silicon valley startup1ai education1origin kit1castle rock platform1rogo1rogo ai1financial ai1investment banking ai1felix1private equity1hedge funds1financial modeling1due diligence1deal sourcing1secure ai1wall street1llms for finance1financial research automation1mezcal1agave-spirits1oaxaca1single-estate1organic-spirits1sustainable-spirits1beverage-manufacturing1tequila-alternative1craft-spirits1carbon-neutral1distintivo-verde1santiago-matatlan1espadin1premium-spirits1ear piercing1nurse-led piercing1hypoallergenic jewelry1medical-grade jewelry1safe piercing1pediatric ear piercing1ear stacking1retail studios1jewelry1consumer brand1licensed nurses1needle piercing1ear care1rowspace1financial intelligence1institutional knowledge1private equity ai1portfolio monitoring1credit analysis1proprietary data1decision intelligence1sequoia1emergence capital1michael manapat1yibo ling1music royalties1royalty processing1music publishing administration1mechanical licensing1royalty accounting1music rights management1catalog registration1white-label royalties1music industry1royalty audit1music licensing1music business management1music finance1military logistics1predictive logistics1edge ai1contested logistics1tyros1offline-first1mesh networking1sustainment1govtech1anduril alumni1series a1arlington virginia1smart building1building automation1heating controls1boiler management1wireless sensors1hvac1local law 971local law 841local law 871energy management1new york city1mushroom coffee1superfoods1medicinal mushrooms1coffee alternative1organic1gluten-free1no jitters1boston startup1consumer health1earthquake risk management1catastrophe risk1structural health monitoring1building sensors1parametric insurance1seismic risk analytics1disaster response1real-time damage assessment1reinsurance1business continuity1san francisco1cruisebound1cruise booking1online travel agency1travel tech1startup founder1ceo1mit1polytechnique montreal1series b1thayer ventures1booking holdings1travel startup1leisure1tourism1mobile-first1canada1industrial engineering1antibody engineering1antibody-drug conjugates1bispecific antibodies1cardiovascular1nrg-11erbb415t41biparatopic adc1protein therapeutics1gaithersburg maryland1biologics1first-in-class1prior authorization1specialty medications1medical benefit1biologics access1patient access1emr integration1pharma market access1benefit verification1rheumatology1retina1neurology1neurotechnology1womens-health1pmdd1menstrual-pain1wearable1tdcs1brain-stimulation1neurostimulation1drug-free1hormone-free1non-invasive1nettle1medical-device1neuroplasticity1menstrual-health1pms1digital-health1health insurtech1small business health insurance1employer sponsored health insurance1group medical plans1level-funded plans1virtual primary care1benefits administration1healthcare cost reduction1austin startup1sana care1headless cms1content operating system1structured content1content lake1groq1portable text1sanity studio1api-first1composable content1ai content1omnichannel1real-time collaboration1content infrastructure1digital experience platform1content management1visual editing1enterprise content1lingerie1intimates1loungewear1size inclusivity1body positivity1inclusive fashion1rihanna1fenty1bras1underwear1mens essentials1bridal lingerie1xtra vip1personalization1ai sizing1fit match1diverse models1apparel1fashion show1amazon prime video1facebook ads1instagram ads1google ads1tiktok ads1meta ads1ad automation1ad optimization1lookalike audiences1retargeting1audience targeting1shopify app1ecommerce ads1dropshipping1roas optimization1ai ad copy1ad creative generation1campaign analytics1ad scaling1media buying1digital marketing software1silicon photonics1integrated photonics1integrated lasers1optical interconnects1dwdm1co-packaged optics1ai data centers1photonic integrated circuits1iii-v on silicon1ship technology1leaf light1optical transceivers1fabless1grenoble1predictive analytics1decision sciences1data engineering1scorefast1customer engagement1fraud detection1contact center ai1financial services1insurance1model management1etl services1ai/ml platform1risk assessment1churn management1call routing1pace program1senior care1geriatric care1culturally tailored care1asian and pacific islander elders1aging in place1medicare medicaid1family caregivers1home health1community-based care1elder care startup1alhambra california1san gabriel valley1oncolytic virus1seneca valley virus1svv-0011cancer immunotherapy1tem81antxr11neuroendocrine cancer1checkpoint inhibitors1viral vector1clinical-stage biopharma1biomarker1armed viruses1philadelphia biotech1mental health1cns therapeutics1ai drug discovery1anxiety treatment1serotonin modulator1ethnopharmacology1natural products1sensai platform1boston biotech1psychoactive medicines1metal additive manufacturing1area printing1metal 3d printing1contract manufacturing1laser powder bed fusion1reshoring1supply chain resilience1high-volume metal production1sustainable manufacturing1digital manufacturing1automotive1wilmington massachusetts1lawrence livermore1nvidia nventures1series c1operational technology1ot security1onboard data1observability1transportation analytics1vehicle cybersecurity1fleet security1serial bus data1mil-std-15531edge computing1gps spoofing detection1rf anomaly detection1aviation security1rail cybersecurity1maritime security1weapon systems1threat detection1edge analytics1national security1digital lending1fintech thailand1ai lending1nano finance1personal loans1credit scoring1e-kyc1siamdl1aithena1bank of thailand1online loans1credit risk1masii1wearable sensors1wireless monitoring1neonatal monitoring1maternal health1vital signs1fda-cleared1ai analytics1global health1hospital-at-home1biosensors1anne one1northwestern spinout1medtech1chicago1infrastructure1data centers1virtual power plant1grid flexibility1alphabet spinout1sidewalk labs1digital infrastructure1battery storage1renew home1verrus1ai compute1public-private partnerships1
Often tagged with
Showing 25 results for community
Sort:
FUNDED!
Women In Product
WI
Palo Alto
CompanyEducationSocial
Women In Product

Women In Product is a 501(c)(3) nonprofit and global community of more than 30,000 women and non-binary product professionals. Founded in 2016 out of a casual networking event in Silicon Valley, it equips members to thrive as builders, leaders, and changemakers through an annual conference, local chapters, leadership programs, peer mentorship, and online resources - with a particular focus on closing the gender gap at the mid-career, senior, and executive levels where it is widest.

2016Founded
Palo AltoHQ
women in productproduct managementnonprofitcommunitywomen in techdiversity and inclusion
LEGEND!
Justine Davis
JD
PersonExecutiveOperator
Justine Davis

Justine Davis is the VP of Developer Marketing, Community, and Developer Relations at ServiceNow, where she oversees a developer community of more than one million members and shapes the narrative of ServiceNow as a global developer platform. With roots in digital marketing and a career arc that ran through Hotwire, Atlassian (over nine years), and Postman, she has built a reputation for translating complex technical products into language that resonates with developers and enterprise buyers alike. Based in Scottsdale, Arizona, she is known for her candid takes on developer marketing, her emphasis on showing rather than telling, and her belief that DevRel and Developer Marketing are two sides of the same coin.

developer-marketingdeveloper-relationsdevrelservicenowcommunitysaas
LEGEND!
Jim Hori
JH
PersonExecutiveOperator
Jim Hori

Jim Hori is President and CEO of the YMCA of Silicon Valley, one of the largest YMCA associations in the United States. He took the helm in June 2022 after 22 years at Silicon Valley Bank, where he served as Managing Director and led the SVB Foundation for 19 years. A Fresno native and Fresno State graduate, Hori spent more than a decade on the YMCA board before being asked to run the place.

ymcasilicon valleynonprofitceocommunityyouth development
LEGEND!
John T. Ehrbar
JT
PersonExecutiveOperator
John T. Ehrbar

John T. Ehrbar is a career YMCA leader who, starting January 26, 2026, takes the helm as President and CEO of the YMCA of Silicon Valley after six years running YMCA Buffalo Niagara. He has spent over two decades inside the Y movement, climbing from a high school Leaders Club kid in northeast Ohio to running an 80-million-dollar nonprofit serving 2,300 staff across the Bay Area.

ymcanonprofitceosilicon valleybuffalospokane
FUNDED!
Arena
A
San Francisco
CompanySaasAi
Arena

Arena is a San Francisco-based audience engagement platform that turns publishers' and brands' own websites into social-network-like communities. Through live blogs, group chats, comments, AI-powered content feeds and audience analytics, Arena helps over 20,000 organizations - including Fox Sports - keep readers on-site, collect first-party data and monetize attention they used to give away to social platforms.

2016Founded
San FranciscoHQ
~$2.3M cumulativeEarlier rounds (Seed and prior)
audience-engagementlive-bloggroup-chatcommunityreal-timeai
FUNDED!
Inkitt
I
San Francisco
CompanyMediaAi
Inkitt

Inkitt is a San Francisco-based AI-powered publishing and entertainment company that uses reader data and machine learning to identify breakout stories before they become hits. Writers upload fiction to Inkitt's community platform; the platform's algorithm tracks reader engagement to surface manuscripts with bestseller potential. Top stories move to Galatea, a premium immersive reading app offering ebooks, audiobooks, and chat-style fiction, and then to CandyJar, a short-drama streaming app. The result: a story-to-screen pipeline with 33 million users, a new million-dollar novel produced every four weeks, and 40x the hit-rate of traditional publishers.

2013Founded
San FranciscoHQ
$37MSeries C
publishingaistorytellingself-publishingdigital-publishingreading
FUNDED!
Kindred
K
San Francisco
CompanyConsumerMarketplace
Kindred

Kindred is a members-only home-swapping network that turns primary residences into a credit-based travel platform. Founded in 2021 by Opendoor alums Justine Palefsky and Tasneem Amina, the San Francisco company has grown to nearly 300,000 members across 150+ cities and raised $125M in combined Series B/C in February 2026 to scale a 'third way' alternative to hotels and short-term rentals.

2021Founded
San FranciscoHQ
$85MSeries C
home-swaptravelmarketplacesharing-economycommunitysan-francisco
FUNDED!
Make:
M
Santa Rosa
CompanyMediaEducation
Make:

Make: is the media and events company that gave the maker movement its name. Founded in 2005 by Dale Dougherty inside O'Reilly Media, it publishes Make: magazine, runs Maker Faire events around the world, and sells kits and books through the Maker Shed. After a 2019 shutdown, Dougherty restructured the business as Make: Community LLC and kept it going.

2005Founded
Santa RosaHQ
$5,000,000Series A
makerdiystemeducationhardwareelectronics
LEGEND!
Graham Gaylor
GG
PersonFounderExecutive
Graham Gaylor

Graham Gaylor is the co-founder and CEO of VRChat Inc., the social virtual reality platform he built from a single Reddit-recruited room in 2014 into a $500M company with millions of custom avatars and hundreds of thousands of user-created worlds. A Vanderbilt-trained mathematician and software engineer who backed the original Oculus Kickstarter, Gaylor has spent over a decade building the infrastructure for human connection in virtual space - a platform where avatars meet, worlds multiply, and the line between game and community blurs entirely.

vrchatvirtual-realityvrsocial-vrmetaversegaming
LEGEND!
Marty Sarim
MS
PersonFounderOperator
Marty Sarim

Marty Massih Sarim is the President of Sanas, a real-time speech AI platform that modulates accents and eliminates background noise for contact center agents globally. An Afghan refugee who came to the US in the early 1980s and started his career at 18 as a call center agent, Sarim brings over 25 years of BPO and contact center industry expertise to Sanas. He is also Co-Founder and General Partner at Carya Venture Partners, a $20M micro-fund focused on deep tech and enterprise AI, and founder of the Moe123 Scholarship Fund, which has awarded $125,000+ to high school seniors in the Minneapolis area.

sanasaicall-centerbpoaccent-translationspeech-ai
LEGEND!
SY
PersonFounderExecutive
Sherman Ye

Sherman Ye is the Founder and CEO of NebulaGraph (vesoft Inc.), the company behind one of the world's most scalable open-source distributed graph databases. After engineering stints at Facebook and Ant Financial — where he worked directly on graph database infrastructure — Ye founded vesoft in 2018 to bring enterprise-grade graph database technology to a market hungry for connected-data insights. NebulaGraph can handle trillions of edges with millisecond latency, and counts Tencent, Meituan, and JD Digits among its users. Ye led the company through a $8M pre-A round in 2020 and a Series A in 2022 led by Jeneration Capital, while pioneering the GraphRAG concept that merges knowledge graphs with large language models.

graph databasenebulagraphopen sourcevesoftdistributed systemsgraph rag
LEGEND!
Tasneem Amina
TA
PersonFounderOperator
Tasneem Amina

Tasneem Amina is the Co-Founder and President of Kindred, a members-only home-swapping platform that lets people exchange homes without exchanging money. Born in South India and immigrated to the US at 14, she studied Biology at the University of Chicago before pivoting into finance and tech. After stints at Goldman Sachs, Yik Yak, and Stitch Fix, she became a product leader at Opendoor - where she grew a business line from $0 to ~$300M in annual volume. She co-founded Kindred in 2021 with fellow Opendoor alum Justine Palefsky after a week locked in a cabin whiteboarding ideas. Kindred has since grown to 300,000+ members and 300,000+ homes across 150+ cities, raising $148M total with a $125M round in February 2026 led by Index Ventures.

co-founderpresidentkindredhome-swappingsharing-economytravel
FUNDED!
Manara
M
Berkeley
CompanyEducationAi
Manara

Manara is a Silicon Valley-backed edtech company training and placing software engineers, AI and cloud talent across the Middle East and North Africa. Through cohort-based learning, mentorship from senior engineers at companies like Google and Meta, and partnerships with AWS, Manara has trained over 300,000 learners and helped hundreds land jobs at global tech firms.

2020Founded
BerkeleyHQ
$3MSeed
edtechmenatech-talentsoftware-engineeringinterview-prepcloud-computing
FUNDED!
ZeeMee
Z
Redwood City
CompanySaasEducation
ZeeMee

ZeeMee is a higher education technology platform that bridges the gap between college-bound students and institutions through authentic community and behavioral intelligence. Founded in 2014 and headquartered in Redwood City, California, ZeeMee gives students a social space to showcase their personalities beyond transcripts while giving colleges AI-powered insights that predict enrollment intent with up to 98% accuracy. With 2.6M+ active student users, 300+ institutional partners, and a 4.7-star app rating, ZeeMee has quietly become one of the most influential platforms in college enrollment - helping students find roommates, discover campus culture, and connect with admissions teams before ever setting foot on campus.

2014Founded
Redwood CityHQ
$1M (approx)Additional Funding
higher-educationenrollment-managementstudent-engagementcollege-admissionsmobilesocial-platform
LEGEND!
Teppei Tsutsui
TT
PersonInvestorExecutive
Teppei Tsutsui

Teppei Tsutsui is General Partner and co-founder of GFR Fund, a San Francisco-based early-stage venture capital firm focused on gaming, generative AI, creator economy, and consumer tech. Tokyo-raised and University of Chicago-educated, he co-founded GFR Fund in 2016 after a decade spanning Mitsubishi Corporation, Morgan Stanley M&A, and GREE - where he moved to San Francisco in 2014 to launch their seed investment program. GFR Fund III closed at $53.5M in 2023, and the firm's portfolio of over 100 companies includes three unicorns - VRChat, Animoca Brands, and Sky Mavis - with GFR's earliest and most famous bet being VRChat, invested when the platform had just 1,000 active users.

venture capitalgaminggenerative aiconsumer techcreator economymetaverse
LEGEND!
Katy Keim
KK
PersonExecutiveOperator
Katy Keim

Katy Keim is the Chief Executive Officer of LeanData, the leading revenue orchestration platform trusted by over 1,000 B2B companies. A marketing and go-to-market veteran with 20+ years across enterprise SaaS, she previously served as CMO of Lithium Technologies and CEO of LQ Digital before joining LeanData's board in 2021 and stepping into the CEO role in July 2025. Katy holds degrees from the University of Virginia (History) and Northwestern's Kellogg School of Management (MBA, Marketing & Entrepreneurship), and has been recognized as an Inspirational Woman in Tech by We Are Tech Women.

ceosaasrevenue-operationsgo-to-marketb2benterprise-software
LEGEND!
Vanessa Didyk
VD
PersonExecutiveFounder
Vanessa Didyk

Vanessa Roth Didyk is the CEO of ZeeMee, a social platform serving 2.6 million college-bound students across 3,000+ institutions. A serial edtech entrepreneur with 16+ years in the field, she founded Scholar's Station at UC Berkeley, sold it, built a tutoring marketplace at Rev.com, ran MathElf, then took over a struggling ZeeMee in 2018 and turned it into a top-10 App Store social networking app used by roughly 1 in 3 US college freshmen annually.

ceoedtechhigher-educationzeemeecollege-admissionsenrollment-management
LEGEND!
Anne-Laure Le Cunff
AL
PersonFounderAuthor
Anne-Laure Le Cunff

Anne-Laure Le Cunff is a French neuroscientist, author, and entrepreneur who burned out at Google, taught herself to code, and built Ness Labs into a 100,000+ reader science-based learning community - all while completing a PhD at King's College London. Her 2025 book 'Tiny Experiments' (Penguin Random House) distills her philosophy: life is a series of experiments and you are the lead scientist. She is now a UKRI-funded postdoctoral researcher studying curiosity and ADHD at KCL, while publishing to 124,000+ Substack subscribers at Hypercurious.

neuroscienceproductivitynewsletterness-labstiny-experimentsadhd
LEGEND!
Ashley Faus
AF
PersonCreatorExecutive
Ashley Faus

Ashley Faus is Head of Lifecycle Marketing, Portfolio at Atlassian, a keynote speaker, Stanford instructor, and author of 'Human-Centered Marketing: How to Connect with Audiences in the Age of AI' (Kogan Page, 2025). She's best known for the 'Content Playground' framework - rejecting the linear marketing funnel in favor of a non-linear, audience-driven content ecosystem. A former musical theater major turned B2B marketing strategist, she argues that trust is the one thing AI cannot automate, and has built a career proving it.

marketingb2bcontent-strategythought-leadershipatlassianlifecycle-marketing
LEGEND!
Rex Salisbury
RS
PersonInvestorFounder
Rex Salisbury

Rex Salisbury is the founder and solo general partner of Cambrian Ventures, a $20M early-stage fintech fund born out of one of the largest fintech founder communities in the US. A former Merrill Lynch banker turned bootcamp-trained software engineer turned a16z partner, Rex built his reputation by running grassroots fintech meetups for years before a single dollar of fund capital. His Cambrian newsletter reaches 20,000 subscribers, his founder-only Slack has 1,100+ members, and his Fund I achieved a ~50% seed-to-Series A graduation rate against a 15.4% industry average. Early backer of Deel, now a $10B+ decacorn.

fintechventure-capitalearly-stagesolo-gpnewslettercommunity
LEGEND!
Matt Ragland
MR
PersonCreatorFounder
Matt Ragland

Matt Ragland is a creator-economy builder, founder of HeyCreator, and host of The HeyCreator Show podcast. He went from camp counselor to ConvertKit employee #5, to full-time creator, building a 100,000+ audience across YouTube, newsletters, and social media. Through HeyCreator and Good People Digital, he helps creators turn their expertise into sustainable businesses via courses, communities, and newsletters. Known for radical transparency, outdoor adventures, and a systems-first approach to creative work.

creator-economynewsletterheycreatoryoutubepodcastingbullet-journal
LEGEND!
Sophie Buonassisi
SB
PersonExecutiveCreator
Sophie Buonassisi

Sophie Buonassisi is SVP of Marketing at GTMfund and GTMnow, where she leads a 58,000+ subscriber newsletter and media brand at the intersection of go-to-market strategy, venture capital, and B2B SaaS. A criminology graduate turned growth marketer, she spent 4.5 years as the first GTM hire at Spiralyze before standing out from 400+ applicants to join GTMfund. She transformed the GTM Newsletter into GTMnow - a full media brand that includes the reacquired Sales Hacker podcast (622+ episodes), a private Inner Circle community, and editorial content reaching 50,000+ founders, GTM leaders, and investors globally.

gtmgo-to-marketmarketingsalesventure-capitalnewsletter
LEGEND!
Sam Parr
SP
PersonFounderCreator
Sam Parr

Sam Parr is a serial entrepreneur and media creator who built The Hustle from zero to 1.5 million subscribers before selling it to HubSpot for ~$27 million. He co-hosts My First Million, a top-25 business podcast with Shaan Puri that pulls over 1 million downloads a month, and co-founded Hampton, a vetted peer community for high-revenue founders now generating ~$8M ARR. Equal parts hustler and storyteller, Parr turned a Nashville hot dog stand into an eight-figure media empire and keeps reinventing what it means to build in public.

entrepreneurnewsletterpodcastmediathe-hustlemy-first-million
LEGEND!
Tara McMullin
TM
PersonStoryFounderAuthor
Tara McMullin

Tara McMullin is a writer, podcaster, and business philosopher who helps small business owners build sustainable, humane companies. Formerly known as Tara Gentile, she spent a decade building a formidable reputation before reclaiming her own name in 2018. She is the founder of What Works, a digital platform and podcast downloaded over 2 million times, co-founder of YellowHouse.Media, and author of books including 'What Works' (Wiley). Drawing on feminist theory, critical sociology, and media studies, she challenges conventional business wisdom with intellectual rigor and a sharp editorial voice.

businessentrepreneurshipsmall-businesspodcastingwritingfeminism
FUNDED!
Luna House
LH
Av. Costa Pinto 560
CompanyStoryConsumer
Luna House

Luna House is Cascais' most-loved coliving and coworking hub — a boutique B&B with nine private rooms in summer, a digital nomad village with community programming in winter. Founded in 2022 by Olena (Lena) Matveieva, it offers coworking for 25 people with 120mb/sec fibre, an event studio, team workation packages, and a resident dog named Luna who consistently out-reviews the human staff.

2022Founded
Av. Costa Pinto 560HQ
Bootstrapped
colivingcoworkingdigital-nomadcascaisportugalbnb