Pricing
TAGS

Tagged Content

Tagged: billionaire

Everything on the platform tagged with billionaire.

Browse all tags
saas12machine learning11biotech9supply chain8fintech8oncology6b2b saas5cybersecurity5clinical-stage5medical devices5san francisco4ai agents4artificial intelligence4logistics4mit-spinout4enterprise software4austin startup4d2c4predictive analytics4healthtech4national security4clean energy4agentic ai3mit spinout3enterprise ai3workflow automation3edtech3data science3automation3telehealth3drug-discovery3iot3b2b3drug discovery3generative ai3decarbonization3inventory management3ai3y combinator3digital health3precision-medicine3agentic-ai3medical-devices3machine-learning3cpg3circular economy3sustainability3llama2developer tools2foundation models2large language models2cleantech2data centers2predictive maintenance2new york startup2freight forwarding23pl2pallet2tpm today2cargowise2drayage2tribal knowledge2journal of commerce2logistics automation2clinical research2cambridge2silicon valley2subscription2autoimmune2ai-drug-development2cell-therapy2car-t2vdi2high-performance computing2hypothesis generation2deep tech2defense2consumer insights2market research2merchandising2back-office automation2bill pay2remote monitoring2new-york2virtual-care2digital-health2augmented reality2mixed reality2precision medicine2aiops2cloud security2crypto2mit2tms2defense tech2aerospace2defense and space2employee benefits2insurtech2benefits administration2health insurance2chicago2immuno-oncology2health tech2genomics2clinical trials2physical ai2human-in-the-loop2saas-platform2subscription app2consumer internet2price optimization2drug-development2environmental services2edge ai2situational awareness2public safety2computer vision2freight2trucking2cancer-immunotherapy2climate tech29111gpu cloud1ai infrastructure1serverless inference1gpu marketplace1open-source models1decentralized compute1ai developers1compute1h1001open access ai1coding agents1ai research1reasoning models1code generation1ai safety1ai unicorn1sculptor1parallel agents1human-centered ai1agi1cooling towers1water recovery1plume abatement1industrial cooling1water sustainability1power plants1ai analytics1waterpanel1towerpulse1electrostatic droplet capture1water conservation1instalily1vertical ai1ai teammates1instaworkers1distribution1erp integration1crm integration1insight partners1series a1coding bootcamp1tech education1web development1data analytics1ux ui design1career change1upskilling1reskilling1remote learning1tech talent1devops1cloud computing1global campuses1spain1miami1container tracking1digital workers1freight tech1autonomous vehicles1self-driving yard trucks1theory of mind ai1sensor fusion1yard automation1autonomous trucking1terminal tractors1fleet automation1cambridge startup1mobile security1mobile edr1spyware detection1pegasus1threat hunting1mobile forensics1byod security1ios security1android security1zero-click exploits1executive protection1threat intelligence1smishing protection1mercenary spyware1academic medical center1nonprofit health system1hospitals1philadelphia healthcare1thomas jefferson university1lehigh valley health network1neurosciences1cardiovascular care1graduate medical education1health plan1patient care1pennsylvania1job search1online community1workforce1recruiting1blue-collar jobs1talent acquisition1social networking1career resources1hiring platform1ai job matching1labor market1resume builder1juicero1cold-press juicer1connected hardware1wifi juicer1doug evans1consumer electronics1health and wellness1venture capital1kleiner perkins1google ventures1startup failure1food tech1sparkling water1organizational memory1sushanth raman1eric johnson1technical-interviewing1interviewing-cloud1hiring1hr-tech1engineering-recruitment1interview-engineers1candidate-assessment1predictive-hiring1diversity-hiring1brilliant-black-minds1ai-interviews1remote-interviews1skill-assessment1interviewing-as-a-service1small-molecule1mass-spectrometry1high-throughput-screening1suzhou1adms-platform1ep4-antagonist1preclinical1computer-aided-drug-design1first-in-class1smart-locks1access-control1oem1embedded-firmware1wifi1bluetooth1keyless-entry1smartlock-technology1pcba1cloud-platform1security1denver1colorado1interoperability1transfection1non-viral-gene-delivery1flowfect1electroporation-alternative1biomanufacturing1crispr1mrna-delivery1cell-engineering1immunotherapy1nk-cells1gmp-manufacturing1microfluidics1vector-database1multimodal-ai1lakehouse1lance-format1open-source1data-infrastructure1apache-arrow1rust1embeddings1feature-engineering1ai-training-data1hybrid-search1vector-search1y-combinator1developer-tools1connection broker1remote desktop access1virtual desktop infrastructure1hybrid cloud1zero trust security1desktop as a service1gpu virtualization1linux vdi1vendor-neutral1boston tech1work from anywhere1photonic computing1silicon photonics1optical interconnect1ai accelerator1co-packaged optics1optoelectronic computing1data center1pcie1cxl1semiconductors1optical network-on-chip1nanophotonics1deep learning hardware1lila sciences1scientific superintelligence1autonomous labs1ai for science1ai science factory1self-driving labs1robotic laboratories1materials science1flagship pioneering1automated experiments1green hydrogen catalysts1antibody discovery1cambridge biotech1human risk management1security awareness training1behavior change1phishing simulation1hrm platform1ai-native security1gamification1security culture1insider risk1behavioral analytics1employee training1cyber risk1raw dog food1human-grade dog food1dog nutrition1pet food1ecommerce1dog supplements1frozen raw1pet health1made in usa1dog wellness1freeze-dried treats1magnesium1critical-minerals1clean-tech1electrolysis1seawater1brine1national-security1metallurgy1light-metals1domestic-manufacturing1supply-chain1voice of consumer1product creation1retail tech1synthetic research1ai testing1assortment planning1apparel1footwear1go-to-market1digital twins1product decisions1restaurant technology1restaurant management software1invoice processing1ap automation1recipe costing1food cost control1daily p&l1foodtech1restaurant accounting1pos integrations1pots replacement1telecommunications1managed wireless1lte routers15g connectivity1life safety systems1fire alarm monitoring1enterprise connectivity1cloud platform1copper retirement1carrier agnostic1elevator phones1kitchenware1cookware1sustainable1direct-to-consumer1knives1cutting-board1recycled-plastic1japanese-steel1copper-core1non-toxic1minimalist-design1heirloom1shopify-plus1consumer-goods1amazon ppc1amazon advertising1ecommerce automation1growth automation1amazon sellers1amazon fba1bid optimization1roas1inventory optimization1advertising optimization1ems1emergency-medical-services1community-paramedicine1public-safety1mobile-integrated-healthcare1triage1care-coordination1non-emergency-call-diversion1telemedicine1healthcare-cost-reduction1civic-tech1surgical navigation1medical imaging1xr901omnifyxr1holographic navigation1interventional radiology1image-guided therapy1fda-cleared13d visualization1cleveland clinic1minimally invasive surgery1ultrasound-guided procedures1ge healthcare1ar in healthcare1cloud msp1managed services1aws partner1multi-cloud1digital transformation1cloud migration1south korea1enterprise cloud1ai-native1cloud consulting1finops1meta1meta platforms1facebook1instagram1whatsapp1messenger1threads1reality labs1metaverse1quest1ray-ban meta1smart glasses1virtual reality1meta ai1open source ai1social media1digital advertising1ad tech1mark zuckerberg1menlo park1big tech1pytorch1blockchain1operational intelligence1digital asset risk management1blockchain monitoring1web31analytics1compliance1risk management1network reliability1real-time monitoring1credit building1debit card1gen z finance1ai personal finance1moneygpt1financial wellness1credit score1young adults1student finance1budgeting1no fees1no interest1financial literacy1neobank1consumer finance1immunology1inflammation1fibrosis1human-genetics1data-science1san-diego-biotech1immune-mediated-diseases1mirador3601clinical-pipeline1biopharma1azure virtual desktop1windows 3651microsoft 3651end-user computing1msp automation1cloud management1daas1microsoft intune1cloud cost optimization1nerdio manager1enterprise it1hybrid work1microsoft partner1brain science1neuromodulation1neurotechnology1pbfs1personalized brain functional sectors1depression1parkinsons1alzheimers1autism1brain mapping1neuroimaging1non-invasive1beijing1brain disorders1neuroscience1wealth-management1wealthtech1ria1financial-advisors1sequoia1ex-revolut1inhalation drug delivery1dry powder nebulizer1dryneb1respiratory therapy1lung disease1medical device1biotechnology1pulmonary medicine1high-dose lung delivery1drug delivery technology1albuquerque biotech1new mexico startup1respiratory infections1inhalation therapy device1hardware testing1mission-critical data1industrial data platform1sensor data1telemetry1edge computing1data observability1hardware-in-the-loop1test automation1dual-use1data infrastructure1engineering software1ground stations1phased array1satellite communications1space infrastructure1ground segment1el segundo1space force1satellite networks1ground network1rf hardware1space data1digital beamforming1scalable ground stations1cancer-detection1bioimpedance1cole-relaxation-frequency1point-of-care1ai-diagnostics1mohs-surgery1biopsy1surgical-margins1medtech1real-time-diagnostics1chicago-startup1marginscan1nscanary1benefits data platform1insurance technology1benefits api1carrier connectivity1benefitsos1api-first1data accuracy1enrollment automation1metal-organic-frameworks1mof1advanced-materials1chemical-separation1semiconductor1chemistry1nanotechnology1gas-storage1decontamination1precision-chemistry1materials-science1industrial-manufacturing1super-resolution microscopy1single-molecule imaging1nanoimager1life sciences1extracellular vesicles1lipid nanoparticles1drug delivery1oxford spinout1codi cloud platform1dstorm1single-molecule localization1nanoparticle analysis1scientific instruments1oral health1dental technology1smart toothbrush1intraoral imaging1teledentistry1consumer health1prophix1preventive care1dental innovation1video toothbrush1hipaa1identity security1access management1iam1identity governance1just-in-time access1least privilege1privileged access management1non-human identity1agentic ai security1policy-as-code1zero trust1access reviews13d-printing1additive-manufacturing1roll-to-roll1computational-design1metamaterials1cosmetics1micro-mesh1mass-customization1materials-foundry1polymer-development1ramp1instaswab1lumofil1digital-manufacturing1usage-based billing1billing infrastructure1revenue management1pricing1saas billing1metering1invoicing1revenue recognition1ai billing1consumption pricing1san francisco startup1adas1autonomous-vehicles1adas-validation1automotive-ai1sensor-fusion1big-data1data-distillation1physical-ai1kpi-automation1homologation1euro-ncap1regression-testing1validation-automation1automotive-software1waltham1b2b-saas1ocean energy1wave energy1marine renewable energy1offshore power1ai data centers at sea1ocean compute1autonomous nodes1public benefit corporation1portland oregon1renewables1ai inference1deep sea energy1terawatt scale1scidb1reveal1life-sciences1multi-omics1biobank1uk-biobank1scientific-data-management1array-database1computational-biology1multimodal-data1translational-informatics1ai-validation1patient-reported outcomes1healthcare analytics1ehr integration1real-world evidence1patient engagement1biostatistics1health systems1med tech1outcomes data1chicago startups1pattern discovery1high-dimensional data1explainable ai1medical diagnostics1healthcare ai1reagent-free testing1raman spectroscopy1friday harbor1robotics1truck unloading1warehouse automation1machine vision1material handling1robotic manipulation1autonomy1distribution centers1industrial robotics1labor automation1no-code ai1nlp1model fine-tuning1content moderation1document intelligence1risk detection1customer insights1on-premise ai1data sovereignty1ai interpretability1experiential-learning1work-integrated-learning1internships1industry-projects1eportfolio1micro-credentialing1employability1higher-education1learning-analytics1ai-feedback1project-based-learning1virtual-internships1mentoring1faith app1daily prayer1bible audio1bedtime bible stories1celebrity narrators1christian community1faith-based media1prayer app1audio streaming1religious content1spiritual growth1los angeles startup1wine ai1spirits ai1beer recommendations1personalization platform1recommendation engine1b2b2c1taste matching1beverage technology1product discovery1consumer preferences1napa valley1retail personalization1sensory data1microschools1education1k-81homeschooling alternative1school choice1personalized learning1mastery-based learning1project-based learning1student-centered1guides1empowered learners1tuition-free1esa1arizona1pricing software1cpq1rebate management1ai pricing1b2b enterprise software1cloud-native saas1price management1price analytics1dynamic pricing1margin improvement1sap partner1salesforce appexchange1pricingai1retail ai1assortment optimization1demand forecasting1competitive intelligence1decision intelligence1retail analytics1pittsburgh startup1house cleaning1home services1on-demand1quick commerce1household help1india1bengaluru1gig work1domestic work1subscription cleaning1instant booking1verified professionals1women workforce1consumer app1startup1digital media1journalism1subscription newsletter1creator economy1insider news1hollywood1washington1wall street1journalist ownership1media startup1podcasts1premium content1political analysis1entertainment news1geothermal1deep-geothermal1millimeter-wave-drilling1gyrotron1clean-energy1renewable-baseload1superhot-rock1energy-transition1fusion-tech1drilling-technology1carbon-free-power1qualitative research1smart sensors1usage intelligence1ai analysis1mobile ethnography1product innovation1video insights1behavioral data1iot sensors1usesights1shopper insights1quantum network1quantum-safe communication1fiber optics1coherent optical network1quantum key distribution1qkd1midwest quantum ecosystem1indiana1infrastructure1low latency1public-private partnership1quantum computing1spend management1corporate cards1expense management1accounts payable1finance automation1ai finance1procurement1travel management1treasury1financial operations1fetal monitoring1fetal pulse oximetry1lumerah1maternal health1obstetrics1cesarean reduction1biophotonics1fda breakthrough device1noninvasive sensor1womens health1childbirth1femtech1pharmaceuticals1hdac-inhibitors1ricolinostat1diabetic-neuropathy1hdac61massachusetts1rare-disease1neuropathy1protein-acetylation1renewance1battery lifecycle management1industrial batteries1battery energy storage1bess1battery recycling1ev batteries1lithium-ion1battery stewardship1decommissioning1renewanceconnect1elmhurst illinois1probiotics1prebiotics1postbiotics1gut health1microbiome1gut-lung axis1gut-x axis1lung health1dietary supplements1physician developed1science backed supplements1metabolic health1respiratory health1transcription1captions1subtitles1speech-to-text1asr1automatic-speech-recognition1legal-tech1diarization1reverb1rev-ai1freelance-marketplace1remote-work1accessibility1api1deposition-summaries1ediscovery1meeting-notes1enterprise-speech-api1defense technology1tactical edge1geospatial intelligence1biometrics1offline intelligence1military software1drone mapping1uas data processing1decision dominance1veteran-founded1revenue intelligence1sales engagement1guided selling1salesforce-native1sales analytics1revenue operations1ai sales assistant1pipeline management1sales forecasting1activity capture1crm automation1sales enablement1deal intelligence1generative signals1enterprise-ai1legacy-modernization1business-logic1digital-transformation1logic-graph1universal-application-notation1koch-disruptive-technologies1washington-dc1technical-debt1application-development1system-of-record1motorcycle rental1peer-to-peer1motorcycle sharing1marketplace1harley rentals1motorsport1sharing economy1insurance1roadside assistance1rider pass1two-wheel mobility1travel1sleep1sleep tracker1energy1circadian rhythm1sleep debt1wellness1productivity1chronobiology1mobile app1performance1non-emergency medical transportation1nemt1healthcare transportation1medicaid1medicare advantage1patient access1health equity1social determinants of health1fleet management1ride scheduling1healthcare logistics1san antonio1care access1mobility management1space domain awareness1space situational awareness1sda sensors1satellite sensors1autonomy software1edge processing1rendezvous proximity operations1space debris1orbital intelligence1leo geo sensors1space safety1us space force1blue origin1national security space1wearable ultrasound1noninvasive neuromodulation1bioelectronic medicine1anti-inflammatory therapy1rheumatoid arthritis1low-intensity focused ultrasound1splenic ultrasound1bio-ultrasonic medicine1long covid1chronic inflammation1drug-free therapy1minneapolis medtech1darpa funded1series a startup1stablecoins1cross-border-payments1remittances1eusd1self-custodial-wallet1mobilecoin1p2p-payments1mobile-payments1freelancer-payments1sentz-earn1digital-dollar1global-payments1transportation management1ai in logistics1real-time visibility1freight automation1shipping1supply chain visibility1il-181engineered-cytokines1decoy-resistant-il-181solid-tumors1directed-evolution1new-haven1yale-spinout1small business1payroll integration1online insurance quotes1medical dental vision1brokers1smb1engagement-as-a-service1edge-computing1smart-mesh1behavior-intelligence1predictive-analytics1white-label-apps1seattle-startup1aws-co-founder1rapid-application-development1smart-stadiums1retail-iot1dispatch1owner-operators1small-fleets1load-board1ai-dispatch1trucking-software1fuel-card1route-optimization1spot-market1miami-startup1transportation1solar panel recycling1solar glass manufacturing1materials recovery1renewable energy1solar waste1end-of-life solar1domestic supply chain1satellite communication1mesh networking1atak plugin1edge networking1tactical communications1jadc21off-grid1blue uas1software-defined network1satcom1first responders1telesurgery1remote-surgery1robotic-surgery1surgical-robotics1health-tech1low-latency1healthcare-it1surgical-access1santa-barbara1series-b1food waste1surplus inventory1liquidation1managed marketplace1food recovery1waste diversion1perishables1pricing intelligence1secondary market1no-code1llm orchestration1agent builder1rag1enterprise search1ai governance1soc 21document processing1asana acquisition1rna epigenetics1epitranscriptomics1mettl3 inhibitor1stc-151cambridge uk1rna modifications1small molecule1cancer therapeutics1mass spectrometry1mrna1programmable-mrna1synthetic-biology1rna-therapeutics1il-121self-replicating-mrna1genetic-medicine1gene-circuits1cambridge-biotech1mlops1ai operations1model deployment1defense ai1model monitoring1data lineage1model governance1responsible ai1chariot platform1automatic target recognition1austin texas1model drift1ml lifecycle1b2b software1metal recycling1swarf recycling1clean industry1metal manufacturing1co2-free recycling1on-site recycling1industrial decarbonization1aluminum recycling1steel recycling1venus-l61electromagnetic heating1surgical quality1second opinion1surgeon outcomes1ai in surgery1ambulatory surgery1employer benefits1medical records1risk-adjusted outcomes1surgigpt1healthcare1rockville maryland1no-code analytics1augmented analytics1conversational ai1manufacturing intelligence1industrial ai1digital twin1jarvix1automl1business intelligence1industry 4.01factory analytics1data integration1ev financing1climate1electric vehicles1auto loans1embedded lending1credit unions1lending-as-a-service1ev finance1auto finance1
Often tagged with
Showing 30 results for billionaire
Sort:
LEGEND!
Tarek Mansour
TM
PersonFounderExecutive
Tarek Mansour

Tarek Mansour is the co-founder and CEO of Kalshi, the first CFTC-regulated exchange for trading on the outcomes of real-world events. A Lebanese-American MIT graduate and former Goldman Sachs and Citadel trader, he turned a regulatory fight into a multibillion-dollar prediction market that lets anyone trade on elections, weather, economics and culture. In May 2026 Kalshi raised $1 billion in a Series F at a $22 billion valuation and became the first American firm to offer crypto perpetual futures under federal regulation.

kalshiprediction marketsevent contractsfintechceoco-founder
LEGEND!
Austin Russell
AR
PersonFounderExecutive
Austin Russell

Austin Russell founded Luminar Technologies at 16, built lidar hardware in his parents' garage, dropped out of Stanford after three months on a Thiel Fellowship, and briefly became the world's youngest self-made billionaire at 25 when Luminar went public in December 2020. His company's 1550nm lidar sensors were integrated into production vehicles from Volvo and Mercedes-Benz, representing a rare case of autonomous vehicle hardware reaching mass-market cars. After a highly publicized attempt to acquire Forbes magazine fell through in 2023, Russell resigned as Luminar's CEO in May 2025 following a board ethics inquiry, and the company filed for Chapter 11 bankruptcy in December 2025.

lidarautonomous-vehiclesluminar-technologiesthiel-fellowshipstanford-dropoutbillionaire
LEGEND!
Jay Chaudhry
JC
PersonFounderExecutive
Jay Chaudhry

Jay Chaudhry is the founder, chairman and CEO of Zscaler, the cloud security company he started in 2007 to replace corporate firewalls with a zero trust internet exchange. A serial founder of five security companies before Zscaler, he took the company public in 2018 and built it into a multi-billion-dollar pillar of the cybersecurity industry.

zscalercybersecurityzero-trustcloud-securitysaasfounder
LEGEND!
Adarsh Hiremath
AH
PersonFounderEngineer
Adarsh Hiremath

Adarsh Hiremath is the Co-Founder and CTO of Mercor, the AI-powered talent marketplace connecting domain experts with AI labs for model training, evaluation, and data creation. At 22, he dropped out of Harvard, received a Thiel Fellowship, and co-built Mercor from a São Paulo hackathon idea into a $10 billion company generating over $500 million in annual revenue - making him one of the world's youngest self-made billionaires alongside co-founders Brendan Foody and Surya Midha.

aimercorco-founderctoharvard-dropoutthiel-fellow
LEGEND!
Brendan Foody
BF
PersonFounderExecutive
Brendan Foody

Brendan Foody is the 22-year-old co-founder and CEO of Mercor, the AI talent and data company that became a $10 billion decacorn in under two years. A Georgetown dropout and former Thiel Fellow from Menlo Park, California, Foody co-founded Mercor with high school debate teammates Adarsh Hiremath and Surya Midha at a São Paulo hackathon in early 2023. Mercor connects AI labs — including OpenAI, Meta, Google DeepMind, and Anthropic — with domain experts (scientists, doctors, lawyers, bankers) who train frontier AI models through human feedback, growing from $1M to $500M in annual run rate within 17 months and making Foody one of the world's youngest self-made billionaires.

aifounderceomercorai-talenthr-tech
LEGEND!
Bret Taylor
BT
PersonFounderExecutive
Bret Taylor

Bret Taylor is the co-founder and CEO of Sierra, an enterprise AI agent platform valued at $15.8 billion following its $950M Series E in May 2026. A Stanford computer science graduate, he co-created Google Maps, helped invent Facebook's Like button, served as Facebook CTO, co-founded Quip (acquired by Salesforce), and rose to co-CEO of Salesforce before founding Sierra in 2023. He also chairs the OpenAI board, having stabilized the company after Sam Altman's brief ouster in November 2023. Forbes recognized him as a billionaire in 2025, and Silicon Valley has nicknamed him the 'Forrest Gump of Silicon Valley' for his uncanny presence at every landmark moment in the internet age.

aisierraopenaigoogle-mapsfacebooksalesforce
LEGEND!
Brett Adcock
BA
PersonFounderExecutive
Brett Adcock

Brett Adcock is a serial entrepreneur and founder of Figure AI, the humanoid robotics company valued at $39 billion after a $1B+ Series C in September 2025. Raised on a third-generation farm in central Illinois, Adcock built his first web companies at 16, co-founded and sold talent marketplace Vettery to Adecco for ~$100M in 2018, took eVTOL company Archer Aviation public on the NYSE at a $2.7B valuation, then pivoted to what he calls the hardest problem: building general-purpose humanoid robots. Figure's robots now work autonomously on BMW's production floor and have logged over 30,000 vehicles built. In 2025-2026, Adcock simultaneously launched Hark (personal AI hardware, $700M Series A at $6B valuation) and Cover (school weapon-detection tech). He is currently running three companies at once while publicly estimating his net worth at ~$19 billion.

humanoid-roboticsfigure-aiarcher-aviationvetteryharkcover
LEGEND!
Joe Garcia
JG
PersonFounderDesigner
Joe Garcia

Joe Gebbia co-founded Airbnb in 2008 out of a San Francisco living room - air mattresses, breakfast included - and turned a half-crazy idea into an $85B company. His current venture, Samara, builds factory-assembled, solar-ready backyard homes (ADUs) that go from permit to move-in in under seven months. In early 2025 he became America's first Chief Design Officer, tasked with redesigning the federal government's 27,000 websites. A Rhode Island School of Design graduate with dual majors in graphic and industrial design, Gebbia approaches every problem - housing affordability, government UX, refugee shelter - through the lens of democratic, empathetic design.

airbnbsamaraco-founderdesigneraduprefab-homes
LEGEND!
Surya Midha
SM
PersonFounderOperator
Surya Midha

Surya Midha is a 22-year-old co-founder and Chairman of Mercor, the AI-powered talent platform valued at $10 billion. A Thiel Fellow, national debate champion, and Georgetown dropout, Midha co-built Mercor from a São Paulo hackathon into a company paying 30,000+ contractors over $1.5 million daily, matching elite human intelligence with AI labs including OpenAI, Anthropic, and Google DeepMind. In 2026, he became one of the youngest people ever to appear on the Forbes World's Billionaires List with a net worth of $2.2 billion.

aimercorco-founderthiel-fellowbillionaireyoungest-billionaire
LEGEND!
Jimmy Donaldson
JD
PersonCreatorFounder
Jimmy Donaldson

Jimmy Donaldson, known globally as MrBeast, is the most-subscribed individual on YouTube with 487+ million subscribers. At 27, he runs Beast Industries, a $5 billion media and consumer goods conglomerate, produces Amazon Prime Video's most-watched unscripted series Beast Games, and has donated tens of millions through initiatives like Team Trees and Team Seas. He reinvests virtually all revenue back into his productions, calling YouTube his true obsession.

youtubemrbeastcontent-creatorphilanthropyfeastablesbeast-industries
LEGEND!
Michael Deng
MD
PersonFounderExecutive
Michael Deng

Michael Deng is the founder, Chairman, President, and CEO of ArcSoft, a Fremont, California-based computer vision and AI imaging company he started in 1994 with $150,000 from family and friends. Over three decades, he built ArcSoft into a global leader powering the cameras of Samsung, Huawei, Xiaomi, Sony, and dozens more, then pivoted to automotive AI vision - driver monitoring, ADAS, and in-cabin sensing. When ArcSoft listed on Shanghai's STAR Market in 2021, Deng became a billionaire with a stake valued at roughly $1.1 billion. Today he's steering the company into AI glasses, XR headsets, robotics, and AIGC creative tools.

computer visionai imagingarcsoftceofoundermobile photography
LEGEND!
Edwin Chen
EC
PersonFounderEngineer
Edwin Chen

Edwin Chen is the Founder & CEO of Surge AI, the AI data infrastructure company that became Anthropic and Google's secret weapon for model training and evaluation. A former ML scientist at Google, Twitter, Dropbox, and Facebook, Chen bootstrapped Surge AI from his San Francisco apartment in 2020 to over $1.2 billion in annual revenue with fewer than 110 employees - no venture capital, no sales team. TIME named him one of the 100 Most Influential People in AI in 2025, and Forbes put him on the 400 list as one of the youngest billionaires. Surge's platform powers RLHF, supervised fine-tuning, and custom evaluations for the world's leading AI labs.

aimachine-learningdata-labelingrlhfnlpsurge-ai
LEGEND!
Michael Truell
MT
PersonFounderExecutive
Michael Truell

Michael Truell is the 25-year-old co-founder and CEO of Anysphere, the company behind Cursor — the AI-native code editor that reached $2 billion ARR faster than any SaaS company in history. A former Google intern and MIT dropout who won the ACM/CSTA Cutler-Bell Prize and IOI medals in high school, Truell co-founded Cursor in 2022 with three MIT classmates, launching it publicly in March 2023. By November 2025, Cursor had raised $2.3 billion at a $29.3 billion valuation — and in April 2026, SpaceX secured an option to acquire the company for $60 billion. Truell's north star: replace coding itself with something better.

aicursoranyspheredeveloper-toolssaasenterprise
LEGEND!
Douglas Leone
DL
PersonInvestorExecutive
Douglas Leone

Douglas Leone is an Italian-born American billionaire venture capitalist and former Global Managing Partner of Sequoia Capital, one of the most storied VC firms in Silicon Valley history. He joined Sequoia in 1988 after stints at Sun Microsystems, HP, and Prime Computer, rose to Managing Partner in 1996, and led the firm's global expansion into China and India. With investments spanning ServiceNow, RingCentral, Nubank, Medallia, and Wiz, Leone helped shape the modern cloud and enterprise software landscape. He stepped back from the senior operational role in 2022 but remains a general partner. As of late 2025, his net worth is estimated at $10.8 billion.

venture capitalsequoia capitalmanaging partnersilicon valleybillionaireitaly
LEGEND!
Sualeh Asif
SA
PersonFounderEngineer
Sualeh Asif

Sualeh Asif is the 26-year-old co-founder and Chief Product Officer of Anysphere, the company behind Cursor - the AI-powered code editor that reached $2 billion in annual recurring revenue faster than any B2B company in history. Born in Karachi, Pakistan, he represented his country at the International Mathematical Olympiad three times before studying at MIT, where he and three classmates built the product that is now rewriting how software gets made. Valued at $1.3 billion on Forbes' 2026 Billionaires List, Asif went from teaching math to Karachi students to co-architecting the tool powering 50,000+ enterprises including Nvidia, Adobe, and Uber.

cursoranysphereaicode-editormitpakistan
LEGEND!
Taavet Hinrikus
TH
PersonFounderInvestor
Taavet Hinrikus

Taavet Hinrikus is an Estonian tech entrepreneur who became Skype's first employee, co-founded Wise (formerly TransferWise) in 2010 - growing it into Europe's largest fintech IPO via a 2021 direct listing at $11B - and now invests through Plural Platform alongside backing social initiatives like kood/Jõhvi coding school. One of Estonia's first billionaires, with a net worth around $1.35 billion, he is also a co-owner of the NBA's Portland Trail Blazers.

fintechwisetransferwiseskypeestoniaventure-capital
LEGEND!
Jim McKelvey
JM
PersonFounderInvestor
Jim McKelvey

Jim McKelvey is the co-founder of Square (now Block, Inc.), a serial entrepreneur, master glassblower, author, and philanthropist from St. Louis. He built Square after losing a $2,000 sale at his glass studio because he couldn't accept American Express - and turned that frustration into a payments company that beat Amazon when it tried to copy them. He's also founded Invisibly, co-founded LaunchCode (a nonprofit that guarantees tech jobs), serves as an Operator Advisor at Redbud VC, and is a former Chair of the Federal Reserve Bank of St. Louis.

squareblock-incfintechpaymentsjack-dorseyinnovation-stack
LEGEND!
Thierry Cruanes
TC
PersonFounderEngineer
Thierry Cruanes

Thierry Cruanes is the co-founder and CTO of Snowflake, the cloud data platform that executed the largest software IPO in US history in September 2020. A French-born database architect with a PhD from Pierre and Marie Curie University, he spent 13 years at Oracle leading query optimization before betting everything on the cloud in 2012 - when Hadoop was supposed to win. He holds over 40 patents, writes code on weekends for fun, and helped architect the compute-storage separation that redefined modern data warehousing.

snowflakedatabaseclouddata-warehousingctoquery-optimization
LEGEND!
Elon Musk
EM
PersonFounderInvestor
Elon Musk

Elon Musk is the wealthiest person in recorded history and the founder or co-founder of nine major companies including SpaceX, Tesla, xAI, and Neuralink. Born in Pretoria, South Africa, he taught himself to code at 10, sold his first game at 12, and dropped out of a Stanford PhD after two days to chase the internet gold rush. His companies collectively own 65% of all operational Earth satellites, produce the world's best-selling electric vehicles, and are actively building brain-computer interfaces and rockets to colonize Mars. As of May 2026, his net worth stands at approximately $809 billion.

elon-muskteslaspacexxaineuralinkentrepreneur
LEGEND!
Hemant Taneja
HT
PersonInvestorFounder
Hemant Taneja

Hemant Taneja is the CEO of General Catalyst, a $40B+ venture capital firm, and one of tech's most unconventional thinkers. Born in Delhi, India, he earned five degrees from MIT before co-founding Livongo Health - sold to Teladoc for $18.5 billion, the largest digital health merger in history. As an early backer of Stripe, Snap, Anthropic, and Canva, and the architect behind GC's audacious move to acquire an actual hospital system, Taneja has spent two decades arguing that building responsibly isn't just the right thing to do - it's the winning strategy. He's signed the Giving Pledge, written four books on technology and capitalism, and is worth an estimated $3.6 billion.

venture-capitalgeneral-catalysthealthcareaitechnologystartup
LEGEND!
John Doerr
JD
PersonInvestorExecutive
John Doerr

John Doerr is the Chairman of Kleiner Perkins and one of Silicon Valley's most consequential venture capitalists. The man who backed Google and Amazon with early checks, taught the world OKRs through his bestselling book 'Measure What Matters', and bet $1.1 billion on Stanford to build the Doerr School of Sustainability. A Rice-trained electrical engineer turned Intel salesman turned legendary VC, Doerr has spent 45+ years turning missionary founders into category-defining companies - and is now directing that same energy toward solving the climate crisis.

venture-capitalokrkleiner-perkinsgoogleamazonclimate
LEGEND!
Josh Kushner
JK
PersonInvestorFounder
Josh Kushner

Josh Kushner is the founder and managing partner of Thrive Capital, a New York-based venture firm he started at age 24 with $5 million and has since grown to $50+ billion in AUM across 10 funds. He made one of the most consequential single bets in VC history by providing the only term sheet OpenAI received in 2022 at a $29 billion valuation. Co-founder of Oscar Health and Cadre, minority owner of the Miami Heat and San Francisco Giants, and husband of supermodel and media entrepreneur Karlie Kloss, Kushner operates from the Puck Building in Manhattan where his apartment and office share the same address. Known for his low-key demeanor, obsessive work ethic, and a hiring process that famously takes eight months.

venture-capitalthrive-capitalopenaioscar-healthfintechhealthcare
LEGEND!
Theresia Gouw
TG
PersonInvestorFounder
Theresia Gouw

Theresia Gouw is a Chinese-Indonesian immigrant who became America's first female billionaire venture capitalist. A Brown-trained engineer turned Stanford MBA, she rose to become the first female investing partner at Accel Partners, where she helped back Facebook at a $98 million valuation in 2005. She co-founded Aspect Ventures and then Acrew Capital, managing ~$1.7 billion with a firm where 85% of employees are women or BIPOC. Beyond VC, she holds minority ownership stakes in the Buffalo Bills, Bay FC, and Golden State Warriors, and is Lead Investor and Executive Chair of an incoming Major League Volleyball franchise in Northern California.

venture-capitalvcinvestorfounderacrew-capitalaspect-ventures
LEGEND!
Alexandr Wang
AW
PersonFounderExecutive
Alexandr Wang

Alexandr Wang is the co-founder of Scale AI and current Chief AI Officer at Meta Platforms. Born in 1997 to Chinese immigrant physicists in Los Alamos, New Mexico, he dropped out of MIT at 19 to build Scale AI, which became the backbone of AI training data infrastructure for companies like OpenAI, Google, Meta, and the U.S. Department of Defense. By 24, he was the world's youngest self-made billionaire. Scale AI grew to a ~$29B valuation after Meta's $14.8B strategic investment in 2025, and Wang now leads Meta's AI superintelligence efforts.

scale-aiartificial-intelligencedata-labelingmit-dropoutbillionairenational-security
LEGEND!
Aravind Srinivas
AS
PersonFounderEngineer
Aravind Srinivas

Aravind Srinivas is the co-founder and CEO of Perplexity AI, the citation-backed AI answer engine that reached a $21B+ valuation in under three years. Born in Chennai in 1994, he earned a dual degree from IIT Madras before completing a PhD at UC Berkeley, then worked as a researcher at OpenAI, DeepMind, and Google Brain before founding Perplexity in 2022. India's youngest billionaire at 31, he has positioned Perplexity as a direct challenger to Google Search by insisting that every AI-generated answer carry verifiable citations - a principle he lifted straight from academic paper standards.

perplexity-aiceofounderartificial-intelligencesearch-enginellm
LEGEND!
Daniela Amodei
DA
PersonFounderExecutive
Daniela Amodei

Daniela Amodei is the President and Co-Founder of Anthropic, one of the world's most influential AI safety companies. A UC Santa Cruz English Literature graduate and former classical flute scholarship recipient, she pivoted from Capitol Hill communications to Stripe to OpenAI before co-founding Anthropic in 2021 alongside her brother Dario Amodei and six other OpenAI colleagues. At Anthropic, she runs all commercial, operational, and cultural operations while Dario leads research and technical strategy — a division of labor that has scaled the company to a $380 billion valuation, over 300,000 enterprise customers, and projected $10 billion in 2025 revenue. Named #1 on Fortune's Most Powerful Women list for 2025 and to TIME's 100 Most Influential People of 2026, Daniela champions a vision of AI safety as competitive advantage, humanities education as future-proof, and 'low politics, high integrity' as the only culture worth building.

anthropicai-safetyco-founderpresidentclaudeopenai-alumni
LEGEND!
Dustin Moskovitz
DM
PersonFounderInvestor
Dustin Moskovitz

Dustin Moskovitz co-founded Facebook in a Harvard dorm room in 2004, then quietly built Asana into a billion-dollar project management company while giving away billions through Open Philanthropy (now Coefficient Giving). The youngest self-made billionaire in the world when Forbes first named him in 2011, Moskovitz has spent the years since turning wealth into what he believes are the most high-impact charitable causes on Earth - from malaria nets to AI safety - alongside his wife Cari Tuna.

facebookasanaopen-philanthropyeffective-altruismbillionairetech-founder
LEGEND!
Henrique Dubugras
HD
PersonFounderExecutive
Henrique Dubugras

Henrique Dubugras is the Brazilian co-founder of Brex, the corporate card and spend management company he built from a Y Combinator pivot at age 21 into a $12.3B peak-valuation fintech unicorn - ultimately acquired by Capital One for $5.15 billion in 2026. He taught himself to code at 12 to avoid paying for a Korean MMO, sold his first payments company (Pagar.me) at 20 while processing $1.5B annually, dropped out of Stanford after 8 months, and found his billion-dollar idea by simply failing to get a credit card for his own startup. Now operating in stealth, he has said he found his 'calling' again.

brexfintechstartupbrazilsilicon-valleyyc
LEGEND!
John Collison
JC
PersonFounderExecutive
John Collison

John Collison is the President and co-founder of Stripe, the Irish-American payments giant he built with his brother Patrick from their rural Tipperary roots into a $159 billion fintech colossus processing $1.9 trillion annually. He sold his first company at 17, dropped out of Harvard at 19, and by 26 was the world's youngest self-made billionaire - all while maintaining the understated disposition of someone who grew up in a village of a few hundred people on Lough Derg.

stripefintechpaymentsirelandstartupbillionaire
LEGEND!
Joe Gebbia
JG
PersonFounderDesigner
Joe Gebbia

Joe Gebbia is the co-founder of Airbnb and a designer-turned-billionaire who helped reshape how humanity thinks about trust between strangers. He graduated from RISD with dual degrees in graphic and industrial design, then turned air mattresses and a breakfast cereal stunt into a $100 billion company. After stepping back from Airbnb in 2022, he founded Samara - a prefab housing company - and in 2025 became America's first Chief Design Officer under the Trump administration, tasked with redesigning the federal government's 27,000+ websites to feel as intuitive as the Apple Store.

airbnbco-founderdesignstartupentrepreneurvc